KEGG   Yersinia pseudotuberculosis MD67: BZ21_3416Help
Entry
BZ21_3416         CDS       T03677                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ypu  Yersinia pseudotuberculosis MD67
Pathway
ypu00010  Glycolysis / Gluconeogenesis
ypu00030  Pentose phosphate pathway
ypu00051  Fructose and mannose metabolism
ypu00052  Galactose metabolism
ypu00680  Methane metabolism
ypu01100  Metabolic pathways
ypu01110  Biosynthesis of secondary metabolites
ypu01120  Microbial metabolism in diverse environments
ypu01130  Biosynthesis of antibiotics
ypu01200  Carbon metabolism
ypu01230  Biosynthesis of amino acids
ypu03018  RNA degradation
Module
ypu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ypu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BZ21_3416 (pfkA)
   00030 Pentose phosphate pathway
    BZ21_3416 (pfkA)
   00051 Fructose and mannose metabolism
    BZ21_3416 (pfkA)
   00052 Galactose metabolism
    BZ21_3416 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    BZ21_3416 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BZ21_3416 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ypu01009]
    BZ21_3416 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ypu03019]
    BZ21_3416 (pfkA)
Enzymes [BR:ypu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BZ21_3416 (pfkA)
Protein phosphatases and associated proteins [BR:ypu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BZ21_3416 (pfkA)
Messenger RNA biogenesis [BR:ypu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BZ21_3416 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AJJ03025
UniProt: A0A3G5ITA4
LinkDB All DBs
Position
3860014..3860997
Genome map
AA seq 327 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSD
MINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGDGSYAGADLLTKEGGIH
CVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAITEKLDDIDSLAKYIEKET
GRETRGTVLGHIQRGGAPVAYDRILASRMGSYAVDLLLQDHDYKKGGFCVGVQNEKMVHE
LISVCIAPENKKSKFKEDWYDTAKKLF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaaattggtgtcctaacaagtggtggtgatgcacccggtatgaatgctgct
attcgcggggttgttcgtgccgctttgtcagcagggttagacgttttcggtattgaagat
ggctatcttggcttatatgaaaatcgtatgaagaagctggatcgctatagcgtgtcagat
atgattaaccgtggcggtactttcctcggatctgctcgtttcccagaattccgcgatccg
gaagtgcgtaaagttgccctcaagaatatgcatgagcgtggcattgatggcttggttgtt
atcggtggtgacggttcttatgctggtgcggacctgctgacgaaagaagggggtattcac
tgtgttggtttaccgggcactatcgataacgatgtggcgggtactgactacaccatcggt
tttttcaccgcactggaaacggtagtggaagccattgaccgcttacgcgatacctcttct
tcccaccaacgtatctctatcgtggaagtgatgggccgctattgcggtgatttaacgttg
gcagccgcgattgccggtggttgtgagtttattgcgatccctgaagttgaatttaaacgt
gatgatctggttgctgaaatcaaagcgggcatcgcgaaaggtaaaaagcacgcgattgtt
gctattactgaaaagctggatgatatcgattcattggctaagtacattgagaaagagacg
ggccgtgaaactcgtggcaccgtgttaggccatatccaacgtggtggtgctccggtggct
tatgaccgcatccttgcttcccgtatggggtcttatgctgtcgatctgctgttacaggac
cacgattacaaaaaaggtggtttctgcgtcggtgtgcagaatgagaagatggtgcatgaa
ttaatttctgtgtgtatcgcgccagagaataagaaaagtaaatttaaagaagattggtac
gatacagcgaagaaactgttctaa

DBGET integrated database retrieval system