KEGG   Yersinia pseudotuberculosis MD67: BZ21_3450Help
Entry
BZ21_3450         CDS       T03677                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ypu  Yersinia pseudotuberculosis MD67
Pathway
ypu00620  Pyruvate metabolism
ypu00680  Methane metabolism
ypu01100  Metabolic pathways
ypu01120  Microbial metabolism in diverse environments
ypu01200  Carbon metabolism
Module
ypu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ypu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BZ21_3450
  09102 Energy metabolism
   00680 Methane metabolism
    BZ21_3450
Enzymes [BR:ypu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BZ21_3450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJJ00916
UniProt: A0A2A7VKU9
LinkDB All DBs
Position
complement(3897849..3900485)
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILDRVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALAQLFTRLKDKKLSDQD
MRSAVDDLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLENSLDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRE
LAGGEEVLEPYRQLMKNVRTQLTNTQAYLEARLKGERVLPPHDLLVSNDQLWEPLYACYQ
SLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDAIAELTRYLGLGDYESW
SESDKQAFLVRELNSKRPLVPLKWEPSAETQEVLETCRVIAEAPQGSIAAYVISMAKVPS
DVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADDVMTQLLGIDWYRGLIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGITLTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAGAILEANLLPPPEPKKEWIEVMDLLS
DASCDMYRSYVRENPEFVRYFRAATPELELGKLPLGSRPAKRRPDGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQRAIDAGKRDVLATMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLAADIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDACVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaacgtcagtatgctcggcacactactcgga
gacaccatcaaggaagcgttgggagagcatattcttgatagagtagaaaccatccggaaa
ttatccaaatcttcgcgtgcgggtaatgaagcgagccgtcaggaattactgaccacactg
caaaatctttccaacgatgagctactgccggtcgcccgtgcctttagccaattccttaat
ctgacgaatacggcagagcaataccacagtatttcaccacatggtgaagccgcgagtaat
ccggaagccctcgcccaattatttacccgcttaaaagataaaaagctgagcgatcaagat
atgcgcagcgcggttgacgatttgtcgattgagttggtcttgactgcccacccaaccgaa
attacccgccgcaccttgatccataaactggttgaagtgaatacctgcctgagccagttg
gatcacaatgatttagccgattacgaacgcaacaagatcatgcgtcgtttacggcagtta
gttgcacaatcgtggcataccgacgaaattcgcaaactgcgtccctcgcccgttgatgaa
gccaaatggggctttgcggtggtggaaaacagcctgtgggaaggcgtccctgcattcctg
cgtgagtttaacgagcagttagagaactcccttgattaccgtctacccgtggaagcggta
cctattcgctttacttcatggatgggcggtgaccgcgatggtaacccgaatgtaacggct
gaaatcactcgccatgtgctgctactcagccgttggaaagccaccgatttattcctgcgt
gatattcaggtgctggtgtctgaactttctatgtcggaatgtaccccggagctgcgtgaa
ttagccggtggtgaagaggtgcttgaaccttatcgccaactgatgaagaacgttcgtacc
caattgaccaatacccaggcttatctggaagcgcgtctgaaaggcgagcgcgtattgcca
ccacacgatttactggtcagtaatgatcaactgtgggaaccgctctacgcctgctatcaa
tcgctgaaagcctgtggcatggaaatcatcgccaacggtcagttgttggataccctacgc
cgcgtgcgttgttttggtgtgccattggtgcgcattgatgtgcgtcaggaaagtacccgt
cataccgatgctatcgcggagctgacccgttatctgggccttggtgattatgagagttgg
tctgaatcagacaagcaagcctttttggtccgcgaactgaactctaagcgcccactggtt
cctctaaaatgggaacctagcgccgagacacaagaagtgctggaaacctgtcgggtgatt
gctgaagcaccgcaaggttctatcgctgcttacgttatctctatggcgaaagtgccgtca
gacgtgctggccgtgcatttgttactgaaagaagcgggttgcccatttactctacctgtc
gccccgctattcgagaccctcgatgacttgaacaacgctgacgatgtcatgacccagttg
ctgggtatcgattggtatcgtggcctgatccaaggcaagcagatggtgatgattggctat
tctgactcggcaaaagacgccggtgttatggcggcctcttgggcacaataccgggcgcag
gatgcactgattaaaacctgtgagaaagccgggattacgctgacattgttccatggccgt
gggggttctattggtcgtggtggtgcgccagcccatgcagcattgctctctcagcctccg
ggcagtctgaaaggcggcttacgggttaccgaacaaggcgagatgattcgctttaagttt
gggttaccggaagtcaccatcagcagcctggcgctgtacgcaggtgcaattctggaagcc
aatctgttaccgccaccagagccgaagaaagagtggattgaagtgatggatctgctgtca
gacgcctcttgcgacatgtatcgcagctacgttcgtgaaaatccagagttcgtccgttac
ttccgtgctgcgacaccggaattggaacttggcaagctgcctctgggttcccgcccagcc
aaacgccgcccggacggtggagtggaaagtctgcgggcgatcccatggattttcgcctgg
acacaaaaccgtctgatgctccctgcctggttgggtgccggtgcgggtttgcagagagcg
atcgatgcaggtaagcgagatgtactcgccaccatgtgccgtgactggccgttcttctcg
acccgcattggtatgctggagatggtcttcgccaaagccgatttgtggctggcagaatat
tatgatcagcgtttagtggataaatcgctatggccgttaggtcagcagttacgtgaccaa
ctggcagccgatattaaagtggtgttggctatcgccaacgatgaccatttgatggctgac
ttgccatggattgccgaatccatcgcgttgcgtaacgtgtacaccgatccattaaacgta
ctgcaagccgagctgttgcaccgttcacgccagcaagaacaccctgatgcctgtgttgaa
caagcgttgatggtgaccattgccggtgtggctgcggggatgcggaataccggttag

DBGET integrated database retrieval system