KEGG   Yersinia pseudotuberculosis MD67: BZ21_4139Help
Entry
BZ21_4139         CDS       T03677                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ypu  Yersinia pseudotuberculosis MD67
Brite
Enzymes [BR:ypu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BZ21_4139 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AJJ03703
UniProt: A0A3G5KRH3
LinkDB All DBs
Structure
PDB: 

Position
4685461..4686030
Genome map
AA seq 189 aa AA seqDB search
MKLSTLLLPVILYSSATLAANMAGMNDKASMNDKASMTVKINESLPQGNGKALGTVTVTE
TAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHLDPNKTGVHLGPY
NDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDNYSDHPMPLGGGG
ARMACGVIE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacattattgctacctgttattctttactccagcgcaacactggccgct
aacatggctggcatgaatgataaggccagcatgaatgataaggctagcatgactgtgaaa
atcaacgaatcattgccacaaggtaatgggaaagcgcttggcaccgtgacggtgactgaa
accgcttatggcttactgtttacgccacatctcactgggctggctccgggaattcacggt
ttccatctgcatgaaaaacccagttgtgctccggggatgaaagatggcaaggcagtgcca
gcattggcagccggggggcatcttgacccaaataagaccggggtacaccttggtccttac
aacgataaagggcatctgggggatctgccgggattggtggttaatgcagatggcaccgcc
acctatcccgtattggctccgcgcctgaaatcgttgtcagaggtgaaacagcatgcgtta
atgatccatgctggcggtgataattactctgatcatccaatgcctttaggcggtggtggc
gcacggatggcatgtggagtcattgagtaa

DBGET integrated database retrieval system