KEGG   Yersinia pestis Shasta: BZ15_2451Help
Entry
BZ15_2451         CDS       T03718                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ypv  Yersinia pestis Shasta
Pathway
ypv00020  Citrate cycle (TCA cycle)
ypv00190  Oxidative phosphorylation
ypv00650  Butanoate metabolism
ypv01100  Metabolic pathways
ypv01110  Biosynthesis of secondary metabolites
ypv01120  Microbial metabolism in diverse environments
ypv01130  Biosynthesis of antibiotics
ypv01200  Carbon metabolism
Module
ypv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ypv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BZ15_2451 (sdhB)
   00650 Butanoate metabolism
    BZ15_2451 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BZ15_2451 (sdhB)
Enzymes [BR:ypv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BZ15_2451 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BZ15_2451 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AJJ51307
UniProt: A0A3N4B892
LinkDB All DBs
Position
complement(2680478..2681194)
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDNAPHMQDYTLDAEEGRDMMLLDALIQLKEKDPTLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALQKGNKKIVIRPLPGLPVVRDLVVDMGQFYTQYEKIKPY
LLNDGKNPPAREHLQSPEQRAKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYR
FLIDSRDTETASRLDDLDDAFSVFRCHSIMNCVSVCPKGLNPTKAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgagttttcaatttatcgctataacccagatgtcgataacgcgccgcatatg
caagattacacgctggatgcggaagaaggtcgggatatgatgttgctggatgcacttatc
cagttgaaagaaaaagatccgacgttgtcattccgtcgctcatgtcgcgaaggtgtgtgt
ggttctgatggtctgaatatgaatggcaaaaatggtttggcctgtattacgccaatctca
gctttgcaaaaaggcaataaaaagatagtgatccgccctctgccggggttaccggtggtg
cgagatttagtcgtcgatatggggcagttttatactcagtatgagaaaataaaaccttac
ctgttgaatgacggcaagaatccaccagcacgtgagcacctacagtcgccggaacaacgg
gcaaaactggatggtttgtatgaatgcatattgtgcgcttgctgctcaacgtcttgtccg
tcattctggtggaatccagacaagtttgttggcccggctgggttactggctgcctatcgt
ttcctgatagatagccgtgataccgaaacggcctcacgtttggatgacctggacgatgct
ttcagtgttttccgctgccatagcattatgaattgtgtcagtgtttgtcctaaaggtctt
aatcctaccaaagcaatcgggcatattaagtctatgctgttacaacgtagcgcatag

DBGET integrated database retrieval system