KEGG   Yersinia pestis Shasta: BZ15_2452Help
Entry
BZ15_2452         CDS       T03718                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ypv  Yersinia pestis Shasta
Pathway
ypv00020  Citrate cycle (TCA cycle)
ypv00190  Oxidative phosphorylation
ypv00650  Butanoate metabolism
ypv01100  Metabolic pathways
ypv01110  Biosynthesis of secondary metabolites
ypv01120  Microbial metabolism in diverse environments
ypv01130  Biosynthesis of antibiotics
ypv01200  Carbon metabolism
Module
ypv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ypv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BZ15_2452 (sdhA)
   00650 Butanoate metabolism
    BZ15_2452 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BZ15_2452 (sdhA)
Enzymes [BR:ypv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BZ15_2452 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BZ15_2452 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 HI0933_like FAD_oxidored BEX Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AJJ51927
UniProt: A0A3N4BI79
LinkDB All DBs
Position
complement(2681244..2683010)
Genome map
AA seq 588 aa AA seqDB search
MNLPIREFDAVVVGAGGAGMRAALQISQMGLSCALISKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAVLELEHMGLPFSRLEDGSIYQRPFG
GQSLNFGGGQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAFVGC
TAINIETGEVVYFKARATILATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKDVLESRLPGILELSRTFAHVDPIKEPIPVIPTCHYMMGGI
PTKVTGQAITVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGMHLQ
ESLMEQGASRDASESDIEASLARMNRWNNTRSGEDPVEIRKALQACMQNNFSVFREGDAM
AKGLEELKTIRERLQNARLDDTSSEFNTQRIECLELDNLMETAFSTAVSANFRTESRGAH
SRFDFPDRDDVNWLCHSLYLPGTESMTRREVNMQPKLREAFPPKVRSY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgccaatcagagagtttgatgcagttgttgtcggtgcaggtggtgccggtatg
cgtgccgccctgcaaatttcacaaatgggcctgtcttgcgccctgatatctaaagtcttc
cctacccgttcccataccgtatctgcgcagggggggattaccgttgcgctgggtaatacc
catgaagataactgggaatggcacatgtacgatacggtaaagggttccgattatatcggc
gatcaggatgccatcgaatatatgtgtaaaaccggtccggaagcggttctggaattggag
cacatgggtttacctttctcccgtttagaggatgggagcatttatcagcgtccatttggg
gggcagtcactgaactttggcggtgggcaagcggcgcgtacagcggctgcagctgaccgc
accggtcatgcgttgttacacaccctttatcagcaaaacctgaaaaaccacaccactatt
ttctctgaatggtatgcactggatttggtgaagaatcaggacggcgcttttgtcggttgt
actgctattaatattgaaaccggcgaagtcgtctatttcaaagcacgggccacaatattg
gcaactggcggtgctgggcgtatttaccaatcaacaaccaatgcgcacattaataccggt
gacggtgttggtatggccttgcgtgctggagtcccggtgcaggacatggaaatgtggcag
ttccacccgaccggtattgccggtgcgggtgtattagtgactgaaggctgccgcggtgaa
ggggggtatttactgaataaacatggtgaacgcttcatggaacgttatgccccgaacgcc
aaagatttggcgggtcgtgatgtagtggcacgttccattatgattgaaatccgtgaagga
cgtggttgtgacggtccttggggcccacatgccaaactgaaattggatcacttaggtaaa
gatgtgcttgaatcccgtctgccgggtattcttgagctgtcgcgcacctttgcacacgtt
gacccgatcaaagaaccgatcccggttatccctacttgccattatatgatggggggaatt
ccgactaaagtgacgggtcaggcgattaccgtaaatgaaaagggtgaggatgttgtgatc
cccggcttgtttgctgtaggcgaaattgcctgtgtttccgtccacggtgcgaaccgcttg
ggagggaactcattactggacttagtggtatttggtcgtgctgccggtatgcacctgcaa
gaatcattgatggagcagggcgcaagccgcgatgccagtgagtcagatatcgaagcctct
ctggctcgcatgaatcgctggaataatacccgttcaggtgaagatccagttgaaatccgt
aaagcattgcaagcctgtatgcagaacaatttctccgtgttccgcgaaggcgatgcgatg
gcaaaagggttggaagagctgaaaactatccgtgaacgtttgcaaaatgcccgtttggat
gacacttccagtgaattcaatactcagcgtattgagtgcctggagctggataacctgatg
gaaactgcgttttcaaccgctgtgtcggcaaacttccgtaccgagagccgaggtgcccat
agccgcttcgatttcccggatcgtgatgatgtgaactggctgtgccattcactgtatttg
ccaggtactgagagcatgacccgccgtgaggtaaacatgcaacctaagctacgcgaggca
ttcccgccgaaagtgcgttcttattga

DBGET integrated database retrieval system