KEGG   Yersinia pestis Shasta: BZ15_3017Help
Entry
BZ15_3017         CDS       T03718                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ypv  Yersinia pestis Shasta
Pathway
ypv00473  D-Alanine metabolism
ypv00550  Peptidoglycan biosynthesis
ypv01100  Metabolic pathways
ypv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ypv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BZ15_3017
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BZ15_3017
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BZ15_3017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypv01011]
    BZ15_3017
Enzymes [BR:ypv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BZ15_3017
Peptidoglycan biosynthesis and degradation proteins [BR:ypv01011]
 Precursor biosynthesis
  Amino acid ligase
   BZ15_3017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_ST ATPgrasp_YheCD TTL RimK ATPgrasp_Ter GARS_A
Motif
Other DBs
NCBI-ProteinID: AJJ49542
UniProt: A0A3N4B812
LinkDB All DBs
Structure
PDB: 

Position
complement(3333448..3334368)
Genome map
AA seq 306 aa AA seqDB search
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFI
ALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQ
QFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIE
KWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYDAKYLSDKTQYFCPSGLSDESEQQLAAL
ALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVAR
ILMLAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaagtcgcggtattgctgggtgggacctctgcggagcgtgaagtgtcatta
ctgtcaggtcaggcggtattggcaggcttgaaagaagccggtatcgatgcttatggggtg
gataccaaagattttccggtaactcagcttaaagaacagggctttgataaagtgtttatc
gccctgcatggtcgtggtggcgaagacggtacgttacaaggcgtattggaatttctacaa
ctgccatataccggcagtggtgtaatggcatccgccctgacaatggacaaattgcgcacc
aaattagtctggcaagccttggggttgcctatttcgccttatgttgcgttgaatcgccaa
cagtttgaaacactttccccagaggaattggtggcgtgtgtcgctaagcttggcctgcca
cttattgtcaagccaagccatgaaggctctagcgttgggatgagtaaagttgatcacgcc
agcgaattgcagaaggcattggttgaagctttccaacatgacagcgatgtactgattgag
aaatggctgagcgggccagagtttactgtcgcgatccttggggatgaagttttgccttct
attcgtattcagcctccgggcgtgttttacgattatgacgctaagtatttgtcagataaa
acacaatacttctgcccaagcggtttaagtgatgagtcggagcaacaattggcagcgctg
gcattgcaggcttaccacgcgctggattgcagcggttgggggcgggtcgatgtgatgcaa
gaccgcgatggtcatttttacctgcttgaagtgaacacttcaccgggtatgaccagccat
agtttggttccaatggccgcccgccagtatgggttgagtttctcccaattggtggcgcgc
attctgatgttggctgactga

DBGET integrated database retrieval system