KEGG   Yersinia pestis Shasta: BZ15_3720Help
Entry
BZ15_3720         CDS       T03718                                 

Gene name
yhjD
Definition
(GenBank) inner membrane protein YhjD
  KO
K07058  membrane protein
Organism
ypv  Yersinia pestis Shasta
Brite
KEGG Orthology (KO) [BR:ypv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BZ15_3720 (yhjD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB CnrY
Motif
Other DBs
NCBI-ProteinID: AJJ49839
UniProt: A0A3N4BBF2
LinkDB All DBs
Position
complement(4095680..4096762)
Genome map
AA seq 360 aa AA seqDB search
MPNAPKDKVTPQVCSQSTAPLAVGIKTGKKAISHMACLSDRIRAYPAIAHIIRATDRFND
RLGSQFGAAITYFSFLSLIPILMVSFVMVGFVLASNPDLLAELINKIVNSISDPALATTL
KNTVNTAIQQRTTVGLTGLAIALYSGISWIGNLREAIRAQSRDVWERNPQDKEKFYYRYA
RDFISLIGLVVALIITLSLTSIAGAAQAAIVNALGLGSIEWLRPAMTLIALSISIAANYL
LFLWIFWILPRNKPKKKALLRGALIAAIGFEVIKFIMTMMLPRLASSPSGAAFGSVIGLM
AFFYFFARLTLFCAAWIATAHDVADNRVESKDIIEDKDIEDKNIEDQNVEDKSLPTRGEK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacgcaccgaaagataaagtcacaccacaggtatgcagtcaatccacagcccca
ctggctgtcgggattaaaaccggcaaaaaagccatctctcatatggcctgcctcagtgat
cgcattagagcctatcccgctatcgcccatattattcgtgcaacagatcgttttaatgac
cggttagggagccaattcggtgccgctattacttacttttcatttttgtcactgatcccc
attttgatggtctcttttgttatggtcggttttgtattagcgtcaaatcccgatctgttg
gctgaattaattaacaaaattgtgaatagcatcagtgacccggcactggccaccacactc
aaaaatacggtgaataccgccatccagcaacgcaccaccgttgggctgaccggcttagcc
attgcgctttattccgggatcagttggatagggaacctgcgcgaagcgattcgggcgcaa
tcacgtgatgtctgggaacgtaatccgcaagataaggaaaaattctattaccgctatgcc
cgggattttatctcactgattgggttagtggtggcgttgattatcacactctcactgacc
tccattgccggtgctgcccaagcggcgatcgtcaatgcgttaggcctggggagtattgaa
tggttacgcccagccatgacgttaatcgcgctatcaatttctattgccgctaactacctg
ttatttttatggatattctggatattaccgcgaaataagccgaagaaaaaagcgctgtta
cgcggagccctcattgccgccatcggttttgaagtaattaaatttatcatgaccatgatg
ctgccgcgcctcgccagttcaccgtctggcgcagcctttggctcggtgattggtttaatg
gctttcttctacttttttgcccgcctaaccttattctgtgcggcttggatagccactgcc
catgatgtagcggacaaccgtgttgagagcaaagacattattgaggataaagacattgag
gataagaatattgaggaccaaaacgtagaagacaagagtttaccaacacgtggagaaaag
taa

DBGET integrated database retrieval system