KEGG   Yersinia pestis Shasta: BZ15_3768Help
Entry
BZ15_3768         CDS       T03718                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ypv  Yersinia pestis Shasta
Pathway
ypv00564  Glycerophospholipid metabolism
ypv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BZ15_3768
Enzymes [BR:ypv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BZ15_3768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C
Motif
Other DBs
NCBI-ProteinID: AJJ51477
UniProt: Q0WA80
LinkDB All DBs
Position
complement(4163530..4164951)
Genome map
AA seq 473 aa AA seqDB search
METKDLACATSSASSKLIHGGLRYLEHYEFRLVSEALAEREVLLKLAPHIAFPMRFRLPH
QPHLRPAWMIRTGLFLYDHLGKRTSLPASKGLRFGPESVLKPELVRGFEYSDCWVDDARL
VVLNVQEVVKHGGEVRTRTKVTRTWREQGLWMVEALDVNTGKTFTWRAKGLVNATGPWVK
QFFDDGLKLKSPYGIRLIKGSHIVVPRVHNQPQAYILQNEDHRIVFVIPWLDDYSIIGTT
DVEYHGDPKEVKIDDQEMTYLLKVYNDHFKKQLGRDDIVWTYSGVRPLCDDESDSPQAVT
RDYTLDVADEAGQAPLLSVFGGKLTTYRKLAEHALEKLSAYYPNVGPAWTKTGALPGGDI
GGSRDSYTVQLRHRYNWLPEGLARRYTRTYGSHSELILANATRLESLGEHFGHGLYEAEL
RYLVENEWVVELDDAIWRRTKLGMALSDEEKQRVAQWLADAHTEKQQALPLVS
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttggcctgtgctacgtcttccgccagttccaaacttatccatggt
ggcttacgctatctggaacattatgaattccgcttggtaagtgaagccttggccgagcgt
gaagtgttactgaaactggcaccgcatatcgcattccctatgcgcttccgcctaccccac
cagcctcatctacgcccggcatggatgatccgcaccggcttgttcttgtatgaccatttg
ggcaaacgtaccagcctgcctgccagtaaagggctgcgttttgggccggaatctgtgtta
aagcccgagttggtgcgcggtttcgaatattctgactgttgggtggatgatgcccgcctg
gtggtgctgaatgtgcaggaagtggttaaacacggcggtgaagtccgaacccgtaccaaa
gtgacccgcacatggcgtgaacaaggcctatggatggttgaagcccttgatgtcaatacc
ggcaaaaccttcacctggcgggctaaaggcttagtgaatgccactggcccttgggttaaa
cagttcttcgacgatggcctaaagctcaaatcaccttatggcatccgcctaattaaaggc
agccacattgtggtgcctcgggttcataaccaaccgcaggcgtatattctgcaaaatgaa
gatcaccgtatcgttttcgttatcccttggttagatgactattccatcatcggtactacc
gacgtggaataccacggcgatccaaaagaggtgaaaattgacgatcaggaaatgacttat
ctgctgaaagtctataacgaccactttaaaaaacagttgggtcgtgacgatatcgtctgg
acctactctggtgtgcgcccgctatgcgacgatgaatcagattcaccgcaagccgttacc
cgcgattacacgctagatgtggccgatgaagcgggtcaggcaccactgctgtcggtcttc
ggcggtaagctcaccacgtaccgtaaattggcagaacatgcgctggaaaaactgtcagcg
tactacccgaatgtcggcccagcgtggactaaaaccggtgccttgcccggtggggatatc
ggcggtagtcgtgatagctataccgtgcaattacgccaccgctataactggttgccggaa
gggttagcccgccgctatacccgtacctatggtagccacagcgagctaattttagccaac
gcgacccgtcttgaaagcctaggtgagcactttggtcacggcttgtatgaggctgaattg
cgctatttggttgagaacgagtgggtcgttgagctggatgatgctatctggcgtcgtacc
aaattaggcatggccctcagcgatgaagagaaacagcgggtagcccagtggctggctgat
gcgcacactgaaaaacaacaggcgctgccgctggtttcttaa

DBGET integrated database retrieval system