KEGG   Yersinia pestis Shasta: BZ15_3887Help
Entry
BZ15_3887         CDS       T03718                                 

Definition
(GenBank) HAD hydrolase, IIB family protein
Organism
ypv  Yersinia pestis Shasta
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AJJ49263
UniProt: A0A2U2GYA1
LinkDB All DBs
Position
4292177..4292986
Genome map
AA seq 269 aa AA seqDB search
MYHVVASDLDGTLLSPNHTLTPYTKETLKLLTQRDVHFVFATGRHHIDVAQIRDNLEISA
FMITSNGARVHNTEGELIFSHNLDADIARDLYNLEHHNPDILTNVYLGDEWFMNRECPEQ
EEFFRESVFNYQVFEPALLPTDGVCKVYFTCEDHDKLLILEEAINARWGDRVNVSFSFPT
CLEVMGGGVSKGHALEQVAKIIGYSLKDCIAFGDGMNDVEMLSMSGKGCIMRDAHQRLKD
VLPNLEVIGSNADDAVPHYLRKMFLGKEE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatgttgttgcttccgatttagatggcacgctgctatcgcctaatcatacgttg
accccttatacgaaagaaacactcaaattgctgacgcagcgtgatgtgcattttgtgttt
gccaccgggcgccaccatatcgatgtggcacaaatccgcgataatttggagatcagtgct
tttatgatcacctctaacggtgcacgcgtgcataacactgagggagaattgattttcagt
cataaccttgatgcggatattgcccgtgatttgtacaatcttgaacatcataatccggat
atcctgactaacgtctatctgggcgacgaatggtttatgaaccgcgaatgtccagagcaa
gaagagttcttccgtgaatccgtgttcaattatcaggtatttgaacctgcattactgccg
actgacggcgtatgtaaggtgtatttcacctgcgaagatcatgacaagttgctgatcttg
gaagaggccattaatgcccgctggggcgatcgcgttaacgtcagcttctccttccctacc
tgcctggaagtgatgggcggcggcgtgtccaaaggccatgcgctggaacaggttgctaaa
atcatcggttattcactaaaagactgtattgcctttggcgatggcatgaatgatgtcgaa
atgttgtcgatgtctggcaaaggctgcatcatgcgcgacgcacatcagcggctaaaagat
gtgttgccgaatttggaagtgataggctctaatgctgatgatgcggtaccacactacttg
cgtaagatgttcttaggtaaggaagagtaa

DBGET integrated database retrieval system