KEGG   Yersinia pestis PBM19: CH59_151Help
Entry
CH59_151          CDS       T03716                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ypw  Yersinia pestis PBM19
Pathway
ypw00473  D-Alanine metabolism
ypw01100  Metabolic pathways
ypw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ypw00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CH59_151 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CH59_151 (alr)
Enzymes [BR:ypw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CH59_151 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ypw01011]
 Precursor biosynthesis
  Racemase
   CH59_151 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AJI89959
UniProt: A0A151PK54
LinkDB All DBs
Position
179304..180533
Genome map
AA seq 409 aa AA seqDB search
MHVRFRHLFLLPLITLVACSQPVSKNHLSLTSLSANAQQPVVNNAWLEISQGALDFNTKK
MLTLLDNKSTLCAILKGDAYGHDLTLVTPVMLKNNVQCIGVASNQELKTVRDLGFTGQLI
RVRSATLKEMQQAMAYDVEELIGDKTVAEQLNNIAKLNGKVLRIHLALNSAGMSRNGLEV
SKARGLNDAKTIAGLKNLTIVGIMSHYPVEDASEIKADLARFQQQAKDVIAVTGLKREKI
KLHVANTFATLAVPDSWLDMVRVGGVFYGDTIASTEYKRVMTFKSNIASLNNYPKGGTVG
YDRTYTLKRDSLLANIPVGYADGYRRVFSNAGHVIIQGQRLPVLGKTSMNTVIVDVTDLK
KVSLGDEVVLFGKQGNAEIQAEEIEDLSGALFTEMSILWGATNKRILVD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcacgttcgttttcgtcatttattcttattaccattaataactttggtcgcttgtagc
caacccgtatcaaaaaaccatcttagcctgacctcactatctgccaacgcccagcaacct
gtagtaaataatgcgtggcttgaaatctctcaaggtgcgctggatttcaatactaaaaag
atgcttacactgctggataataaatccacactttgtgcaatattaaaaggtgatgcctat
ggacatgacctgaccttagtcacaccggtgatgctaaaaaacaatgtgcaatgtattggg
gttgccagcaatcaggaactaaaaacggtacgtgatctaggatttacgggtcagttgata
cgggtcagaagtgcaacattaaaagaaatgcaacaagctatggcttacgatgttgaagaa
cttattggcgataaaaccgtcgctgagcagttaaataatattgcaaaactgaatggaaaa
gttctgcgtatccatctggcactgaactccgcagggatgtctcgtaatgggctggaggtc
agtaaggcccgcggtttaaatgacgcaaagacaattgcaggtttaaaaaatctgacaatc
gttggcatcatgtcgcactacccggtggaagatgctagcgaaatcaaagcagacttggct
cgattccagcaacaagccaaagatgttatcgcggtcacggggctaaaacgtgaaaagatt
aagctccacgtcgccaatacattcgcgaccttagcggtgcctgattcatggttggatatg
gtccgtgtgggaggggtgttttatggtgacaccatcgccagcacagagtataagcgggtc
atgaccttcaaatctaacatcgcatcgctgaacaactaccctaagggcggtactgttggc
tatgaccggacctatacattgaaacgtgattccctgctggcgaatatccccgtgggttat
gccgatgggtatcgccgagtatttagtaatgcggggcatgtgattattcaaggtcagcgc
ctgcccgtattaggcaaaacatcaatgaatacggtcatagtagacgtcaccgatctgaaa
aaagtgagtttaggtgatgaagttgtcttgttcggtaagcaaggcaatgcggaaattcag
gcagaagaaattgaagatctcagtggcgcactctttaccgaaatgtcaattctgtggggc
gcaaccaataagcgtattctggtagattaa

DBGET integrated database retrieval system