KEGG   Yersinia pestis D182038: YPD8_0131Help
Entry
YPD8_0131         CDS       T01833                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00550  Peptidoglycan biosynthesis
ypx01100  Metabolic pathways
ypx01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YPD8_0131
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    YPD8_0131
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ypx01003]
    YPD8_0131
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypx01011]
    YPD8_0131
Enzymes [BR:ypx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     YPD8_0131
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YPD8_0131
Glycosyltransferases [BR:ypx01003]
 Polysaccharide
  Bacterial polysaccharide
   YPD8_0131
Peptidoglycan biosynthesis and degradation proteins [BR:ypx01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   YPD8_0131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase DUF3502
Motif
Other DBs
NCBI-ProteinID: ACY60821
LinkDB All DBs
Position
complement(159428..161572)
Genome map
AA seq 714 aa AA seqDB search
MRKIKEAFLAIRIEQMLTKDEILELYLNKIYLGYRAYGVGAAAQVYFGKEVHELTLSQIA
MIAGLPKAPSTFNPLYSHDRAVARRNVVLLRMLDEKYITQAQYDQARSEELVANYHVPQI
AFSAPYLAEMVRQEMIKRYGENAYTDGYQVYTTITRKLQLAAVDSLRANVLAYDMRHGYR
GPSNVLWKVGESAWSREQIIDSLKALPVYGPLLPAVVTEADAAQATAMLADGSNVTLPMV
GIRWARPFKSDNAQGPVPKKATDVVQPGQQIWVRKVDDNWWLAQVPDVNSALVSIDPNNG
AIKALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGLTLATILNDLPITRWDSG
AGTDWRPKNSPPTYDGPIRLRQGLGQSKNVVMVRAMRAMGVDYAAEYLQRFGFPAQNIVH
SESLALGSASFTPLQLVRGYAVLANGGYLVDPYFITKITDDVGNVLFETKPKVVCDNCNL
PVIYGDTQRSVVLSDDNIENVATSQNQNASNVPMPELEQVTPAQTTLNSEQQYAPHVIST
PLAFLMRDALNSNIFGEPGWMGTGWRAGRDLKRKDIGGKTGTTNSSKDAWFSGYGPDTVT
SVWIGFDDHRRNLGRSTASGAIPDQISGAEGGAKTAQPAWNDFMKVALEGLPEKQVPPPP
GIVSVVIDKQTGKLSNGGPGSRSEYFIDGTQPTEHTVHEVGTTLMDNGQTHELF
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaatcaaggaagcatttctggctatccgcatcgaacagatgctgaccaaagat
gaaatccttgagctgtatctgaacaaaatttatctcggttaccgcgcctatggtgtcggt
gctgcggcccaagtctatttcggcaaagaagtccatgaattgaccctcagccaaatagcg
atgatcgccgggttacctaaagcgccttctacgtttaacccgctctactcacatgacaga
gccgtggcacggcgtaatgtggtgctgctacgtatgctggatgaaaaatacatcactcag
gcgcaatacgatcaagcccgcagtgaagagttggtggctaactaccatgtaccgcaaatc
gccttttcagcgccctatctggctgaaatggtgcgtcaggagatgattaaacgttacggt
gaaaatgcgtataccgacggttatcaggtctataccacgattaccagaaagctacagttg
gcggcagttgattcattacgcgccaacgtgctggcttatgatatgcgccatggctatcgc
ggcccgtccaatgtgttatggaaggtgggcgaaagtgcctggagccgtgaacagattatc
gattcactgaaagcattgccggtgtatggcccgctgttacctgcagtagtcaccgaggcg
gatgccgcacaagctacggcaatgctggctgatggcagcaacgtgaccttgccgatggtc
ggtatacggtgggcgcgtccgtttaaatcggataacgcccaaggtccggtccccaaaaaa
gcgactgatgtcgttcagcctggtcagcaaatttgggtcagaaaggtcgatgataactgg
tggctggctcaagtgccggacgtcaattctgcgctggtgtctatcgatcccaataacggt
gcaattaaagcgctagtaggcggttttgattttaaccaaagcaaatttaaccgggcaacg
caggcactgcgtcaggttggctcgaatattaagccattcctgtataccgccgcgatggac
aaaggcctgacgctggccactatcctcaatgacctgccaatcacccgttgggattctggc
gcaggcaccgactggcggccaaaaaactcacctcccacttacgatggccctatccgtttg
cgtcagggtttaggccaatcgaaaaacgtggtcatggtgcgggcaatgcgggccatgggg
gtggattacgcggctgagtatttgcagcgctttggtttccctgcgcagaatatcgtgcat
tcagaatcactggctctgggttctgcctcctttacaccattacagctagtccgtggctat
gccgtgctagcaaatggcggttacctggttgatccgtacttcatcactaaaatcactgat
gatgtcggtaatgttctgtttgaaacaaagccgaaggttgtctgtgataactgtaacttg
ccggtcatttacggtgatacccaacgttcagttgtactttctgacgacaatattgagaac
gttgcaacctcgcagaaccagaatgccagtaacgtgccaatgccagagctggaacaggtg
acaccggcacaaacgacgctaaatagcgaacagcaatatgcgccacacgtgataagcacc
ccgctggcgttcttgatgcgtgatgcattgaattctaatattttcggggaacctggctgg
atgggtacgggctggcgtgcgggtcgtgacctgaaacgtaaggatatcggcggtaaaacg
ggtacgacaaacagctcgaaggatgcctggttctccggctacggcccagataccgtgaca
tccgtctggattggctttgatgaccatcgccgtaatttgggccgcagcacggcatcaggg
gcgataccagaccaaatttccggagcagaaggcggggcgaagacggcccagccagcatgg
aatgactttatgaaggtggcgcttgagggcttgccagagaagcaggttccaccaccaccg
ggtatcgtcagtgtcgtgattgataagcaaacaggcaagttatctaatggcgggccgggc
agccgctcagagtactttatcgacgggacacaacccactgagcatacggtacatgaagtt
ggtaccacattgatggataacggccagactcacgaactgttctga

DBGET integrated database retrieval system