KEGG   Yersinia pestis D182038: YPD8_0480Help
Entry
YPD8_0480         CDS       T01833                                 

Gene name
ftsI
Definition
(GenBank) penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00550  Peptidoglycan biosynthesis
ypx01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YPD8_0480 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    YPD8_0480 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypx01011]
    YPD8_0480 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ypx03036]
    YPD8_0480 (ftsI)
Enzymes [BR:ypx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YPD8_0480 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:ypx01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   YPD8_0480 (ftsI)
Chromosome and associated proteins [BR:ypx03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    YPD8_0480 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: ACY61170
LinkDB All DBs
Position
589733..591496
Genome map
AA seq 587 aa AA seqDB search
MKTARPGKLKRQEEQASFISWRFALLCGCILLALVGLIMRTAYLQVINPDKLVREGDMRS
LRVQEVPTARGMISDRSGRPLAVSVPVNAVWADPKELIEQGGISLDTRWKALSDALEIPL
DQLATRINANPKGRFVYLARQVNPAIGDYIRKLKLPGIHLRQESRRYYPAGQVMAHIIGV
TNIDGQGIEGVEKSFDRWLTGQPGERTVRKDHYGRVIEDISSVDSQAAHNLVLSVDERLQ
ALVYRELNNAVAFNKAESGTAVLVDVNTGEVLAMANSPSYNPNNLTGTPKDAMRNRAITD
IFEPGSTVKPMVVMTALQHGVVKENSVLNTLPYFVNGHQIKDVARYAELSVTGILQKSSN
VGVSKLALAMPSSALVDTYSRFGFGKATNLGLVGESSGLYPKKQRWSDIERATFSFGYGL
MVTPLQLARVYATIGSMGVYRPLSITRVDPPVAGERIFPEPLVRTVVHMMESVALPGGGG
TKAAIKGYRIAIKTGTAKKVGPDGKYMDRYLAYTAGVAPASNPRFALVVVINDPQAGKYY
GGAVSAPVFGAIMGGVLRTMNIEPDALPTGDKSELVINTKEGSGGRS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagcgcgccccgggaagttaaagcgtcaggaagaacaagccagctttattagc
tggcgttttgcgttgctgtgcggttgtattttactggcattggttgggctgattatgcgt
accgcatacctgcaagtgatcaaccccgataagctggtgcgcgagggggatatgcgctcg
ctgcgagtacaagaggtgccgacggcgcgtggcatgataagcgatcgctctggccgccct
ttggcggtcagtgtacccgtcaatgcggtttgggccgatccaaaagaactgattgaacag
ggggggatctctctggatacccgctggaaagccctgtcggatgcattagaaatcccttta
gatcaacttgccacgcgcattaatgccaatccaaaaggccgctttgtctatctggcccgt
caggtgaaccccgcgattggcgactacatccgcaagctgaaattacccggtatccatcta
cgtcaggaatcccgtcgctactatccggcaggtcaggtgatggctcacattattggtgtg
accaatatcgatgggcaagggattgaaggtgttgagaaaagttttgatcgctggctcacc
ggccaaccgggcgagcgaacggtgcgcaaagaccattatggccgtgttattgaagatatc
tcctctgttgacagccaggcggcgcataacctggtgctgagtgtggacgagcgtttgcag
gcgttggtgtaccgcgagctcaataatgcggtggcgtttaacaaagcagaatcgggcacg
gcggtattagtcgatgtgaacaccggtgaagtcttggcgatggcgaacagcccgtcttac
aacccgaataacctaaccggtacgccgaaagacgcgatgcgtaaccgggcaataaccgat
atttttgaacccggctcgacagtcaagccaatggtagtgatgacggccttacagcatggt
gttgtgaaagagaacagtgtgctgaataccttgccgtactttgttaacggtcaccagatt
aaagacgtggcccgttacgctgagctatccgtcactgggatcttacagaagtcgagtaac
gtcggtgtttctaaactggcgttagcgatgccatcctcagcgttagtagatacttactca
cggtttgggtttgggaaagcgaccaatttggggttggtcggagaaagcagtggcttatat
cctaaaaaacaacggtggtctgacatagagagggccaccttctctttcggctacgggcta
atggtaacaccgttacaactagcgcgagtctatgcaaccatcggcagcatgggggtctat
cgcccgctgtcgataacccgagttgacccacctgtcgccggtgaacgcatcttccctgaa
cccctggtacgcaccgtggttcatatgatggaaagcgtggcactgcctggcggtggtggt
accaaagcggcgatcaaaggctaccgtatcgcgattaaaaccggtacggccaaaaaagtc
ggtcccgatggcaagtatatggatcgatacctcgcttacaccgctggcgttgcgcccgcg
agtaaccctcgatttgctctggttgtggtgatcaatgacccgcaggcagggaaatattac
ggtggtgcggtttctgcaccggtattcggtgccatcatgggcggcgttttacgcaccatg
aacattgagccagatgcgttacccaccggtgataaaagcgaattagtgattaatacaaaa
gagggttcaggtggcagatcgtaa

DBGET integrated database retrieval system