KEGG   Yersinia pestis D182038: YPD8_1480Help
Entry
YPD8_1480         CDS       T01833                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ypx  Yersinia pestis D182038
Brite
Enzymes [BR:ypx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YPD8_1480 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACY62165
LinkDB All DBs
Position
1892174..1892752
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVINLNNLIKDTEFAGKSLEEIVKTA
NGGVFNNAAQVWNHTFYWHCLSPNGGGEPTGKIAEAINKSFGSFAEFKAQFTDAAVKNFG
AGWTWLVKKADGTLAIVSTSNAGTPLTTTDKPLLTVDVWEHAYYIDYRNARPKYLENFWA
VVNWSFAEKNLD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattacctgcattaccttacgcgcaaaatgcgctggaaccccacatctct
gccgaaacgctggaataccattatggtaagcaccacaacacctatgtgatcaacctcaat
aatctgattaaagatactgagtttgcaggcaaatcactggaagagatcgtgaaaaccgcc
aatggcggtgtgtttaataatgcggcccaagtttggaaccataccttctactggcattgc
ctgtcgccaaatggaggcggtgaacctactggaaaaatcgccgaggccattaataagtct
tttggctcatttgctgaatttaaagcgcaatttactgatgctgccgtgaaaaactttggc
gctggttggacgtggctcgttaaaaaagcggatgggacattggcgattgtcagtacttct
aacgcaggaacaccgctgacaacaacagataaacccctgttgaccgtcgatgtgtgggaa
catgcttactatattgattaccgtaatgcgcgaccaaaatatctggagaatttctgggca
gtagttaactggtctttcgctgagaaaaacctagactga

DBGET integrated database retrieval system