KEGG   Yersinia pestis D182038: YPD8_2098
Entry
YPD8_2098         CDS       T01833                                 

Definition
(GenBank) sensor protein kinase
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx01503  Cationic antimicrobial peptide (CAMP) resistance
ypx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YPD8_2098
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    YPD8_2098
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypx01001]
    YPD8_2098
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypx02022]
    YPD8_2098
   01504 Antimicrobial resistance genes [BR:ypx01504]
    YPD8_2098
Enzymes [BR:ypx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     YPD8_2098
Protein kinases [BR:ypx01001]
 Histidine kinases
  OmpR family
   YPD8_2098
Two-component system [BR:ypx02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   YPD8_2098
Antimicrobial resistance genes [BR:ypx01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    YPD8_2098
SSDB
Motif
Pfam: PhoQ_Sensor CstA_5TM
Other DBs
NCBI-ProteinID: ACY62777
LinkDB
Position
2677249..2677989
AA seq 246 aa
MLRKNNKPFSLRARFLMATAGVILALSLSYGMVAVVGYIVSFDKSTFRAHRGESNLFFSL
AQWHNNKLSISVPPELELNVPSLVLIYDKDGNILWRQRHVPELESHIEKSWLQKPGFYEL
DTGTHISRMMMGDNPKAQDQLKKYDDTDDSALTHSVSVNTYAATSRLPQLTIVVVDTIPQ
ELQRTDLVWNWFSYVLLANLLLVIPLLWLAAYWSLRPIKARASQISQLEKGEREQLDENH
LVSYKV
NT seq 741 nt   +upstreamnt  +downstreamnt
atgctcagaaaaaataataaacccttctcccttcgagcccgttttcttatggcgacagcc
ggcgttattttagcgctgtcgctatcttatggcatggtcgcggtggtaggttatatcgtc
agttttgataaaagcaccttcagagcccatcgtggtgaaagtaatttattcttcagtctg
gcacagtggcataacaataagctcagcatctctgttccgccagaacttgaactgaacgtc
cccagcctggtcctgatttacgacaaagatggtaatattttatggcgtcagcgtcatgtc
cctgagctggagtcgcacattgagaaaagctggctgcaaaagccggggttttatgagctg
gataccgggacgcacatcagtagaatgatgatgggtgacaacccaaaagctcaagatcag
ttaaagaaatacgatgacaccgatgatagcgcacttacgcactcagtctccgtcaatacc
tacgccgcgacctctcgtttacctcaactcaccatcgtggtggtggataccatcccacaa
gagctacaacgtactgatctagtgtggaactggttcagttatgtcctgctggcgaattta
ttattagtcattcccttattgtggcttgctgcctattggagcctgcggccaattaaagca
cgggctagtcaaatcagccagttggaaaaaggtgagcgtgaacaactcgatgaaaaccac
ctcgtgagttacaaagtttag

DBGET integrated database retrieval system