KEGG   Yersinia pseudotuberculosis YPIII: YPK_0278Help
Entry
YPK_0278          CDS       T00665                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ypy  Yersinia pseudotuberculosis YPIII
Brite
Translation factors [BR:ypy03012]
 Eukaryotic Type
  Elongation factors
   YPK_0278
 Prokaryotic Type
   YPK_0278
Mitochondrial biogenesis [BR:ypy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    YPK_0278
Exosome [BR:ypy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YPK_0278
  Exosomal proteins of breast cancer cells
   YPK_0278
  Exosomal proteins of colorectal cancer cells
   YPK_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ACA66591
UniProt: A0A0H3AX45
LinkDB All DBs
Position
316152..317336
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSAYDFPGDDLPVVRGSALKALE
GEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIK
PHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNINMI
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtaccaaaccccatgtaaacgtcggtactatcggccac
gttgaccatggtaaaactaccctgacagcagcaatcaccaccgttctggctaaaacctac
ggcggtagcgctcgtgctttcgatcaaatcgataacgcaccagaagaaaaagcacgtggt
atcaccatcaacacttctcacgttgaatatgatactcctgctcgtcactatgcgcacgtt
gactgcccaggtcacgccgactatgttaaaaacatgatcaccggtgctgctcagatggat
ggtgcaatcctggttgttgctgcaactgatggccctatgccacagactcgtgagcacatc
ctgttgggtcgtcaggttggcgttccttacatcatcgtattcatgaacaaatgtgacatg
gttgatgatgaagagctgctggaactggtagaaatggaagttcgtgaacttctgtctgct
tacgacttccctggcgatgatctgccagttgttcgtggttcagcgctgaaagcactggaa
ggcgaagctgagtgggaagctaaaatcatcgaactggctggttacctggattcttatatc
ccagaaccagaacgtgctatcgacaagccgttcctgctgccaatcgaagacgtattctct
atctcaggccgtggtactgtagtaactggtcgtgtagagcgcggtatcgttaaagtcggc
gaagaagttgaaatcgtcggtatcaaagatactgttaaatctacttgtactggcgttgaa
atgttccgcaaattgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagatatcgaacgtggtcaagttctggctaaaccaggttctatcaaa
ccacacactacctttgaatcagaagtttatattctgagcaaagatgaaggcggccgtcat
actccgttcttcaaaggctaccgtcctcagttctacttccgtacaactgacgtaaccggt
accatcgaattgccagaaggcgttgaaatggtgatgccaggtgacaacatcaacatgatt
gttaccctgattcacccaatcgcaatggacgacggcttgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgctggtgttgttgctaaagtaatcgcttaa

DBGET integrated database retrieval system