KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_0798
Entry
YPK_0798          CDS       T00665                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypy02044]
    YPK_0798
Secretion system [BR:ypy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPK_0798
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACA67099
UniProt: A0A0H3B5A6
LinkDB
Position
906784..907284
AA seq 166 aa
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNIN
KNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVALTFREMKDFEPESVARQIPQLRALLAM
RNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAPKEG
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtcctcttcaagcttccaaaatgagatacctaaagcacgcattaacatcaaattagac
ctgcatactggcggggcgcaaaagaaagtcgaactgcctttgaagttgttggtgatgggc
gattacagcaacggtcaggagcagcgcccgctgtctgaacgtgaaaaactcaatatcaat
aaaaacaattttaacagtgtgctggctgaattccaaccgagcctgaaactcgctgtaccg
gacacgctggccggggataacaccgatacagccgtcgctttgaccttccgcgagatgaaa
gatttcgaaccggaaagcgtcgcccgtcaaatcccgcaactgcgcgccttgctggcgatg
cgcaacctgctgcgagacctcaaatccaatctgctggacaacgccaccttccgccgtgag
ctggaaaatatcctcaaagacgatgccttgagcgatgaactgcgcgctgaactggcggcc
ctggcaccaaaagagggttaa

DBGET integrated database retrieval system