KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_2634Help
Entry
YPK_2634          CDS       T00665                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy00061  Fatty acid biosynthesis
ypy01100  Metabolic pathways
ypy01212  Fatty acid metabolism
Module
ypy_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YPK_2634
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ypy01004]
    YPK_2634
Enzymes [BR:ypy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     YPK_2634
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     YPK_2634
Lipid biosynthesis proteins [BR:ypy01004]
 Fatty acid synthase
  Component type
   YPK_2634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ACA68911
UniProt: A0A0H3B3H6
LinkDB All DBs
Position
2890003..2890629
Genome map
AA seq 208 aa AA seqDB search
MAITLAKLVQPGLIGLAQRTAVRYSAHFTNIRLTENMVDKRESYTKEDLEASGRGELFGA
GGPPLPAGNMLMMDRIVKMIEDGGSHNKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGL
DAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPDAKKVTYRINFKRVIMRKLIMGVA
DGEVLVDGKVIYTATDLKVGLFKDTNAF
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccattacgctggctaaactggttcaaccagggctaatcggacttgctcagcgtaca
gctgtacgctattctgcgcacttcactaacataaggcttactgagaacatggtagataaa
cgcgaatcctatacaaaagaagaccttgaagcatccggccgtggcgagttgtttggcgct
ggtgggccacccttacccgcaggcaatatgttaatgatggaccgtattgtcaaaatgata
gaagacggtggcagccataataaaggttatgtggaagcggaactggatatcaatccagat
ctatggttcttcggttgccattttatcggtgatcccgtcatgcctggctgtctgggcctt
gatgccatgtggcagttggttggtttctatctcggctggctcggtggcgaaggcaaaggc
cgcgcactgggtgttggtgaagttaaattcaccggccaggtgctgccagatgcgaaaaaa
gtgacataccgtattaattttaaacgcgtgattatgcgtaaattaattatgggcgttgcg
gatggtgaagtcttggttgatggcaaagtgatttacactgccactgatttgaaagtaggt
ctgtttaaagacaccaacgctttctaa

DBGET integrated database retrieval system