KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_2740Help
Entry
YPK_2740          CDS       T00665                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy00550  Peptidoglycan biosynthesis
ypy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YPK_2740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ypy01002]
    YPK_2740
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypy01011]
    YPK_2740
Enzymes [BR:ypy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YPK_2740
Peptidases [BR:ypy01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   YPK_2740
Peptidoglycan biosynthesis and degradation proteins [BR:ypy01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   YPK_2740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACA69017
UniProt: A0A0H3B5N2
LinkDB All DBs
Position
complement(3022410..3023615)
Genome map
AA seq 401 aa AA seqDB search
MMKYILPFKIKNFTFSAGLLLLALPAAYAVDDPAAPQIDAKAYVLMDFNSGKVLAEGNPD
LRLDPASLTKIMSSYVIGQSIKAGKIQPDDLVTVGKDAWATGNPALRGSSLMFLKPGDRV
KVSDLNKGIVIQSGNDASIALADYVAGSQDSFVGLMNNYAKALGLSNTHFMTVHGLDSPG
QYSTARDMALLGQALIRDVPEEYALHKEKEFTFNKIRQTNRNRLLWNSSLNVDGMKTGYT
NGAGYNLVASATDGPMRLISVVLGAPSDKVRFSESEKLLTWGFRFYETVVPIKSTKPFVT
EKVWLGDNSQVELGVAEDAAITIPKGQMKNLKASYTLNQTELRAPLAKHQVVGTIDFQLN
GKTIEQRPLVVLNEVKEGGIFSRFWDYVMMKLNQWFGGIFG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatatatcctccctttcaagattaaaaattttacgttcagtgcaggtttattg
cttctggcactgcctgctgcttatgcagtcgatgaccctgccgctccccagattgatgct
aaagcttatgtgctgatggattttaatagcggaaaagtgctggcagaaggcaatcctgat
ctgcgccttgatccggccagtttgacaaaaatcatgtccagctatgtgatcgggcagtcg
attaaagcgggcaaaatacagcctgatgatctggtcaccgtggggaaagacgcctgggcg
accggtaacccagctctgcgcggctcgtcgctgatgtttttgaagccgggcgatcgggta
aaagtgtctgatctcaacaaaggcattgtgatccaatcaggtaatgatgccagtattgca
ttggctgattatgtcgcgggtagtcaggacagttttgttggcctgatgaataactacgct
aaagcacttggcctgagtaatactcactttatgacggtacacggcctggattcaccgggg
cagtacagtactgcgcgtgatatggctttactggggcaggcattgatccgcgatgtgcca
gaagaatatgcgctgcataaagagaaagaatttacctttaataaaattcgccaaaccaac
cgtaaccggctgttatggaacagtagtttaaacgttgatgggatgaaaaccggttatacc
aacggggcggggtataatttggtcgcatcggcgacagatgggccgatgcgtttgatttcc
gtggtgctgggtgcaccaagtgacaaagtacgctttagtgaaagtgaaaaattgctgact
tggggtttccgcttctatgaaaccgtggtgccaattaaatcaacaaagccatttgtgaca
gagaaagtgtggcttggcgataacagccaggttgaacttggggtggcggaggatgcggcg
atcaccattcctaaagggcagatgaaaaatctgaaagccagttataccctgaaccaaacc
gagctacgcgcgccgctagcgaaacatcaagtggttggaaccatcgattttcaactcaat
ggcaaaaccattgaacagcgcccactcgtggtgttgaatgaggtcaaagaggggggcatc
tttagccgtttctgggattacgtaatgatgaaacttaaccaatggtttggtgggatattc
ggctaa

DBGET integrated database retrieval system