KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_3152Help
Entry
YPK_3152          CDS       T00665                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Pathway
ypy00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ypy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YPK_3152
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ypy01007]
    YPK_3152
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypy03016]
    YPK_3152
Enzymes [BR:ypy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     YPK_3152
Amino acid related enzymes [BR:ypy01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   YPK_3152
Transfer RNA biogenesis [BR:ypy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    YPK_3152
 Prokaryotic type
    YPK_3152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 Mut7-C
Motif
Other DBs
NCBI-ProteinID: ACA69423
UniProt: B1JHJ1
LinkDB All DBs
Position
complement(3446999..3448384)
Genome map
AA seq 461 aa AA seqDB search
MLKIFNTLSRQKEEFKPIHAGKVGMYVCGITIYDLCHIGHGRTFVAFDVVARYLRYLGYS
LTYVRNVTDVDDKIIKRAIENNETCEQLTTRMLAEMHKDFDALNLERPDLEPRATHHIAE
IIEMTERLIARGHAYVASNGDVMFAVDSDPDYGVLSRQDLDQLQAGARVEVADVKRNPMD
FVLWKMSKPGEPRWESPWGPGRPGWHIECSAMNGKQLGAHFDIHGGGSDLMFPHHENEIA
QSTCAHDGPYVNYWMHSGMVMIDKEKMSKSLNNFFTIRDVLAYYDAETVRYFLMSGHYRS
QLNYSEENLKQARASLERLYTALRGTDANATPAGGVEFEARFRTAMDDDFNTPEAYSVLF
DIAREVNRLKNEDMAAANGLAAELRKLAQVLGLLEQDPELFLQGGAQADDDEVAKIEALI
KQRNDARSSKDWALADAARDQLNDLGIVLEDGPQGTTWRRK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagatttttaatacactgagtcgccaaaaagaggaattcaagcctatccatgcc
ggtaaagtgggtatgtatgtatgcgggatcactatttatgacctgtgtcacattgggcat
gggcgcacttttgtcgctttcgatgttgtggcgcgttatttgcgttatttaggttactct
ctgacgtatgtccgcaatgtcactgacgttgacgataagatcattaaacgtgcgattgag
aataatgagacttgtgagcaactgacaacgcggatgctggcagagatgcacaaagatttt
gacgcattaaatcttgagcgccctgatttggagccgcgtgcgactcaccatatcgctgaa
ataattgagatgaccgagcgcttaattgctcggggccatgcttatgttgcctctaacggc
gatgtgatgtttgcggtcgatagcgatcctgattacggtgtgttatcccgacaggatctg
gatcaactacaggccggtgcacgggttgaagtggctgatgttaaacgtaatccgatggat
ttcgtgctgtggaaaatgtccaaaccgggtgagccacgctgggaatcaccttgggggccg
ggccgccctggttggcatattgaatgttcagcaatgaacggcaaacagttaggcgcgcat
tttgatattcacggcggcggctctgatttgatgtttccgcaccacgagaacgagatcgct
caatctacctgcgcacacgatggcccgtatgtaaattactggatgcactctggtatggtg
atgatcgacaaagagaaaatgtcgaagtccctgaataacttcttcactattcgcgatgtg
ctggcgtattacgatgccgaaaccgtgcgttacttcttgatgtccggtcattatcgtagc
cagcttaactacagcgaagagaatctgaagcaggcacgcgcttcactggagcgtttatat
accgcgctgcgcggtactgatgctaacgctacgccagcagggggcgttgaatttgaagcc
cgtttccgcacggcaatggatgatgatttcaatacaccagaagcctattcggtgctgttt
gacatcgcccgcgaagtcaaccgcctgaaaaacgaagatatggccgctgccaatggtctg
gccgctgagttacgtaaattggctcaggtgctgggcttattagaacaggacccagagctg
tttttacaaggcggtgcgcaggctgatgacgacgaagtagcaaaaatcgaagccctgatt
aagcaacgtaatgatgcccgcagcagcaaagattgggcgttggcagatgccgcacgtgat
caattgaatgatctgggtattgtgctggaagatggcccgcaaggcacgacatggcgccgc
aagtaa

DBGET integrated database retrieval system