KEGG   Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_3445Help
Entry
YPK_3445          CDS       T00665                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ypy  Yersinia pseudotuberculosis YPIII (serotype O:3)
Brite
Enzymes [BR:ypy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YPK_3445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACA69712
UniProt: A0A0H3B5F6
LinkDB All DBs
Structure
PDB: 

Position
complement(3778490..3779095)
Genome map
AA seq 201 aa AA seqDB search
MKLITLLLPVILYSSATLAANMAGMNDKAGMNDKAGMNDKASMNDMASMTVKINESLPQG
NGKALGTVTVTETAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHL
DPNKTGVHLGPYNDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDN
YSDHPMPLGGGGARMACGVIE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaattacattattgctacctgttattctttactccagcgcaacactggccgct
aacatggctggcatgaatgataaggctggcatgaatgataaggctggcatgaatgataag
gccagtatgaatgatatggctagcatgactgtgaaaatcaacgaatcattgccacaaggt
aatgggaaagcgcttggcaccgtgacggtgactgaaaccgcttatggcttactgtttacg
ccacatctcactgggctggctccgggaattcacggtttccatctgcatgaaaaacccagt
tgtgctccggggatgaaagatggcaaggcagtgccagcattggcagccggggggcatctt
gacccaaataagaccggggtacaccttggtccttacaacgataaagggcatctgggggat
ctgccgggattggtggttaatgcagatggcaccgccacctatcccgtattggctccgcgc
ctgaaatcgttgtcagaggtgaaacagcatgcgttaatgatccatgctggcggtgataat
tactctgatcatccaatgcctttaggcggtggtggcgcacggatggcatgtggagtcatt
gagtaa

DBGET integrated database retrieval system