KEGG   Yersinia pestis Z176003: YPZ3_1009Help
Entry
YPZ3_1009         CDS       T01210                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase catalytic subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00020  Citrate cycle (TCA cycle)
ypz00190  Oxidative phosphorylation
ypz00650  Butanoate metabolism
ypz01100  Metabolic pathways
ypz01110  Biosynthesis of secondary metabolites
ypz01120  Microbial metabolism in diverse environments
ypz01130  Biosynthesis of antibiotics
ypz01200  Carbon metabolism
Module
ypz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPZ3_1009 (sdhB)
   00650 Butanoate metabolism
    YPZ3_1009 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YPZ3_1009 (sdhB)
Enzymes [BR:ypz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YPZ3_1009 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     YPZ3_1009 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: ADE63919
LinkDB All DBs
Position
1305132..1305848
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDNAPHMQDYTLDAEEGRDMMLLDALIQLKEKDPTLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALQKGNKKIVIRPLPGLPVVRDLVVDMGQFYTQYEKIKPY
LLNDGKNPPAREHLQSPEQRAKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYR
FLIDSRDTETASRLDDLDDAFSVFRCHSIMNCVSVCPKGLNPTKAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgagttttcaatttatcgctataacccagatgtcgataacgcgccgcatatg
caagattacacgctggatgcggaagaaggtcgggatatgatgttgctggatgcacttatc
cagttgaaagaaaaagatccgacgttgtcattccgtcgctcatgtcgcgaaggtgtgtgt
ggttctgatggtctgaatatgaatggcaaaaatggtttggcctgtattacgccaatctca
gctttgcaaaaaggcaataaaaagatagtgatccgccctctgccggggttaccggtggtg
cgagatttagtcgtcgatatggggcagttttatactcagtatgagaaaataaaaccttac
ctgttgaatgacggcaagaatccaccagcacgtgagcacctacagtcgccggaacaacgg
gcaaaactggatggtttgtatgaatgcatattgtgcgcttgctgctcaacgtcttgtccg
tcattctggtggaatccagacaagtttgttggcccggctgggttactggctgcctatcgt
ttcctgatagatagccgtgataccgaaacggcctcacgtttggatgacctggacgatgct
ttcagtgttttccgctgccatagcattatgaattgtgtcagtgtttgtcctaaaggtctt
aatcctaccaaagcaatcgggcatattaagtctatgctgttacaacgtagcgcatag

DBGET integrated database retrieval system