KEGG   Yersinia pestis Z176003: YPZ3_1325Help
Entry
YPZ3_1325         CDS       T01210                                 

Gene name
fabZ
Definition
(GenBank) myristoyl-acyl carrier dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00061  Fatty acid biosynthesis
ypz00780  Biotin metabolism
ypz01100  Metabolic pathways
ypz01212  Fatty acid metabolism
Module
ypz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YPZ3_1325 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YPZ3_1325 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ypz01004]
    YPZ3_1325 (fabZ)
Enzymes [BR:ypz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     YPZ3_1325 (fabZ)
Lipid biosynthesis proteins [BR:ypz01004]
 Fatty acid synthase
  Component type
   YPZ3_1325 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA NKWYS
Motif
Other DBs
NCBI-ProteinID: ADE64235
LinkDB All DBs
Position
1717114..1717638
Genome map
AA seq 174 aa AA seqDB search
MKNTELNFLKTNFLFNQDITNELNTSFGQDIIKKMIPHREPFLMVDNVELINIECRLIKA
IRRVDEKDPVFGGHFPNDPIYPGVLQQESMFQTALILMYFLLNETAIPPAEENIIHAVGT
RVYDVFHLSAVRPGELMTIRCCITEYDTFLATAIVQITVNDQIVTVGKGEFHVF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatactgaattaaattttttaaaaacgaattttttatttaaccaagatattact
aatgaattgaatacatcatttggacaagatatcattaaaaaaatgataccgcatcgtgaa
ccatttttaatggtcgacaacgtagagctgatcaatattgaatgcaggttaataaaagca
ataagaagagttgacgaaaaagacccggtatttggtggtcatttccccaatgaccctata
tatccaggtgtattgcaacaagaaagtatgtttcaaaccgcgcttattttaatgtatttt
ctgctaaatgaaacggctattccgccagcagaggagaatatcatccacgcagtgggaaca
cgagtatacgatgtctttcacttgtccgcagtacgcccaggagaattaatgacaatccgt
tgttgtattacagaatacgacacatttcttgccaccgccattgttcaaatcacggttaac
gatcagatcgtaaccgtcggaaaaggagagtttcatgtcttctga

DBGET integrated database retrieval system