KEGG   Yersinia pestis Z176003: YPZ3_2295Help
Entry
YPZ3_2295         CDS       T01210                                 

Gene name
dacA
Definition
(GenBank) putative penicillin-binding protein 5
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00550  Peptidoglycan biosynthesis
ypz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YPZ3_2295 (dacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ypz01002]
    YPZ3_2295 (dacA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypz01011]
    YPZ3_2295 (dacA)
Enzymes [BR:ypz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YPZ3_2295 (dacA)
Peptidases [BR:ypz01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   YPZ3_2295 (dacA)
Peptidoglycan biosynthesis and degradation proteins [BR:ypz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   YPZ3_2295 (dacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ADE65205
LinkDB All DBs
Position
complement(2978187..2979389)
Genome map
AA seq 400 aa AA seqDB search
MKYVITSRIIKSLALGTVIVMSAANADDVNLKTMIPGVPQIDAEAYILIDYNSGKVLAEM
NADTRRNPASLTKMMTSYVIGQAIKSGKIGAEDMVTVGKDAWATGNPEFKGSSLMFLKPG
DRVPVSKLTRGINLQSGNDACVAMADYVAGSQDSFVNLMNNYVKALGLQNTHFKTVHGLD
AEGQFSSARDMALIGQALIRDVPDEYAIYKEKEFTFNNIRQTNRNGLLWDTSLNVDGIKT
GHTEAAGYNLVASATDGQMRLISVVLGGHTFKGRETESKKLLTWGFRFFETVAPLKVGKE
FASEPVWFGDSDRVQLGVDKDAYLTIPRGRMKDLKASYVLNTPEIHAPLAKNQVVGTINF
QLDGKTIDQRPLVVMNEVKEGGFFSRMVDYIKLMFHRWFG
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaattacctctcgcattatcaagagcctagcgctcggcactgttattgtc
atgagcgctgctaacgctgatgacgtcaatctgaaaaccatgatccccggcgtaccgcag
atcgacgcagaagcctacatcctaattgattacaactccgggaaagtattggcggaaatg
aacgcggatacgcgccgcaacccagccagtttgaccaaaatgatgaccagctacgtcatc
ggccaggcgattaaatcagggaaaatcggggctgaagacatggtcaccgtgggtaaagat
gcctgggctaccggtaacccggaatttaaaggctcctccctgatgtttctgaaaccgggc
gaccgtgtgccggtgtctaaactgacccgtggtatcaacttacaatcgggtaacgatgcc
tgcgtcgcgatggccgattatgtcgcggggagtcaggactcattcgttaacctgatgaac
aactatgttaaggcgctgggcttacaaaatacccacttcaaaactgttcacggtttagat
gcggaaggccagttcagctctgcacgcgatatggcattgattggtcaagccctgatccgt
gatgtgccagatgagtatgctatctataaagagaaagagtttaccttcaacaatatccgc
cagacaaaccgtaacggtttactgtgggacaccagtttgaacgtagatggcatcaaaacc
ggtcacaccgaggcagcaggttataatctggtcgcatcagcgactgatggacagatgcgt
ttgatttcagtcgttttaggcggccatacctttaagggccgtgaaactgaaagtaaaaaa
ctgctgacctgggggttccgtttctttgaaaccgtcgcaccgctgaaagtcggtaaagag
tttgcctcagaaccggtctggtttggcgatagtgatcgtgtgcagttaggtgtagataaa
gatgcttatctgactattccacgtggccgaatgaaagacctgaaagccagctatgtgctg
aatacacctgaaattcatgcgccactggcgaaaaaccaagttgtgggaaccattaacttc
cagttagatggtaaaaccatcgatcagcgcccattggtggtgatgaacgaagtaaaagaa
ggtggtttcttcagccgtatggtggattatatcaagctgatgttccaccgctggtttggc
taa

DBGET integrated database retrieval system