KEGG   Yersinia pestis Z176003: YPZ3_2556Help
Entry
YPZ3_2556         CDS       T01210                                 

Gene name
faoA
Definition
(GenBank) putative fatty oxidation complex alpha subunit, enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00071  Fatty acid degradation
ypz00280  Valine, leucine and isoleucine degradation
ypz00281  Geraniol degradation
ypz00310  Lysine degradation
ypz00362  Benzoate degradation
ypz00380  Tryptophan metabolism
ypz00410  beta-Alanine metabolism
ypz00640  Propanoate metabolism
ypz00650  Butanoate metabolism
ypz00903  Limonene and pinene degradation
ypz00930  Caprolactam degradation
ypz01100  Metabolic pathways
ypz01110  Biosynthesis of secondary metabolites
ypz01120  Microbial metabolism in diverse environments
ypz01130  Biosynthesis of antibiotics
ypz01200  Carbon metabolism
ypz01212  Fatty acid metabolism
Module
ypz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    YPZ3_2556 (faoA)
   00650 Butanoate metabolism
    YPZ3_2556 (faoA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YPZ3_2556 (faoA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPZ3_2556 (faoA)
   00310 Lysine degradation
    YPZ3_2556 (faoA)
   00380 Tryptophan metabolism
    YPZ3_2556 (faoA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPZ3_2556 (faoA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YPZ3_2556 (faoA)
   00281 Geraniol degradation
    YPZ3_2556 (faoA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YPZ3_2556 (faoA)
   00930 Caprolactam degradation
    YPZ3_2556 (faoA)
Enzymes [BR:ypz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YPZ3_2556 (faoA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YPZ3_2556 (faoA)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YPZ3_2556 (faoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADE65466
LinkDB All DBs
Position
complement(3300071..3302395)
Genome map
AA seq 774 aa AA seqDB search
MSKENIVTRENTAVSENAVSEPTVNNDVGASATNSVTHPAFTLNVRPDNIGIITIDVVGD
KVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARVL
AQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGLL
PGSGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAGW
LNRRALPWQERLLSGPLGKALLFRIVRKKTLAKTRGHYPAAERIIDVVRKGLDQGGPSGY
EAEARAFGELAMSPQSAALRSLFFATTSLKKETGSAATARAIHRVGVLGGGLMGGGIANV
TATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRGF
ERVDIVVEAVFEDLSLKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGLH
YFSPVDKMPLVEVIPHEKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINEA
ARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQLGPRFAAPPSFD
VILKDGRKGRKNGRGFYLYSNPTKNSSPTKNGNSPAKRNSFKWRKNKVKPVDASIYTLLG
VTPKAHLGAGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRYL
DSLGADKVVQALRLLVQQYGERFEPCQRLVTMAEQQQQFYPVDANIDEVTDVAS
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggaaaatatcgttacccgtgaaaatacagctgtcagtgaaaatgcagtcagt
gaacctacagtgaataatgatgtgggcgcatcggccacgaattcagttacccatcccgca
tttaccctcaacgtaaggccggacaatattggcattatcaccattgatgttgttggtgac
aaagtgaataccctaaaggctgaatttgctgatcaaattgccactatattgcaacaagcg
cacgctctaccaaaattacagggactcgtcattgtttctggcaaaccagactccttcatt
gccggtgcggatatcacgatgatcgcggcttgtcgtaccgctcacgacgcccgcgtatta
gcacaaaaaggccaatcaattttggcgcaaattgccgctttccctgtgccggttgtggct
gcgattcatggcgcttgtctggggggagggctagagctggcgctggcttgccatagccgc
atatgttctctggatgataaaaccgttctcgggctaccggaggtgcaactggggttactg
cctggctccggcgggacgcaacgtctgccgcgtttagtgggggtcagtaaagcactggat
atgatattgaccggtaaacagatacggccccgtcaggcactaaaaatggggctggtggat
gatgttgtgccacgcgatatcttattggatgtggcgattcagcgcgcgaaagcggggtgg
cttaatcgacgagcattaccatggcaggagcgtttactcagtgggccgttgggtaaagct
ttattattccgtattgtccgtaaaaaaacgctagctaaaacgcgggggcactacccggcg
gctgaacgtattattgatgtggtgcgtaaaggattagatcagggcgggccaagtggttat
gaggcagaagccagagcatttggcgagttggcgatgtcgcctcagtcagccgcattacgc
agcctgttttttgccacgacgtcactgaaaaaagagaccggaagtgcagccacagcgcgt
gcaattcatcgggtcggcgtattgggcggtggcttgatgggcggaggtattgccaacgta
acggctacccgagcgggcttgccagtgcgtatcaaagatatcaatccgcaaggaattaat
caggcgctgaaatatacctgggacgcattgggtaaacgggttcgtagtaagcggatgcgc
ccaactgaacagcagcggcagatgatgttgatctctggtagtacggattaccgtggtttt
gaacgtgtcgatattgtggtggaagcggtatttgaggatttatcactgaagcagcaaatg
gttgctgacatcgaacgatttggtgccgcccatactatttttgcctccaatacatcatca
ctccccatcagccagattgctgctttggcgcaacggccagagcaggttattggcctgcac
tattttagtccagtagataaaatgccactggttgaagtcatcccccatgaaaaaaccagt
gaagagaccatcgctaccaccgttgctttagcccggaaacagggtaaaacagccattgtg
gtggctgatcgcgctgggttctatgtaaaccgcattttggcaccttatattaatgaagct
gcccgttgcctgctcgacggagagcctatcgaatcagttgataacgcgttggtcgatttt
ggtttccccgtaggccccatgatgctgcttgatgaggttgggattgatgttgcgaccaaa
ataatgccgattctggtcgagcaattagggccgcgttttgctgcgcccccgtcatttgac
gttattttgaaggatggacgtaaagggcgcaaaaatggccgtggcttttatttatattca
aaccccacaaaaaattcatctccaacaaaaaatgggaattctccggcgaagcgtaatagc
tttaagtggagaaaaaacaaagtaaaaccagtcgatgccagtatctataccttgttgggg
gtgacacctaaagcccatcttggtgcaggcgtgattactcaacgttgtaccatgctgatg
ttgaacgaagcggtacgctgtctggatgaatcgatcattcgtaacccgcgcgatggtgat
attggtgcagtgtttgggatcggttttccgcctttcctcggtggtccgttccgctatttg
gatagcctgggagccgataaggtggtacaagcactcagattattggtacagcaatacggt
gagcgtttcgaaccttgccagcggttggtaacaatggctgaacaacaacaacaattctat
cccgtggacgccaatatagatgaggtgacggacgtggcaagctga

DBGET integrated database retrieval system