KEGG   Yersinia pestis Z176003: YPZ3_3381Help
Entry
YPZ3_3381         CDS       T01210                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00564  Glycerophospholipid metabolism
ypz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    YPZ3_3381 (glpA)
Enzymes [BR:ypz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     YPZ3_3381 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 DAO_C FAD_oxidored Thi4 NAD_binding_8 Pyr_redox_2 3HCDH_N HI0933_like Pyr_redox_3 SO_alpha_A3 GIDA
Motif
Other DBs
NCBI-ProteinID: ADE66290
LinkDB All DBs
Position
complement(4339128..4340783)
Genome map
AA seq 551 aa AA seqDB search
MTNSSPYLETDVIIIGGGATGAGIARDCARRGLACTLLERHDIATGATGRNHGLLHSGAR
YAVTDGESARECIEENRILKRIARHCIEQTDGLFITLPEDSLAYQLQFIARCRDAGIEAE
AIDPAQALRLEPAVNPALIAAVRVPDGTVDPFRLTAANMLDAREHGANILTYHEVIGLLR
QGSRINGVCVFDHKNQRKYDIHAQIVVNAAGIWGQHIAEYADLRIRMFPAKGALLILGHR
INNMVINRCRKPADADILVPGDTISLIGTTSTHINYDQIDNMVVTAQEVDTLIREGAKLS
PQLAQTRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHASRDGVEGFITITGGKLMTYR
LMAEWATDKVCEKLGISAACTTAQVPLPGSRQSAEQTLSKVISLPASIRGSAVYRHGDRA
TQLLVGNRLDNSLVCECEAVTAGEVRYAVESLSVNNLLDLRRRTRVGMGTCQGELCACRA
AGLLSRFKVTTPQQSREQLTQFLNERWKGVRPIAWGDALRESEFTQWVYQGLCGLDEIPA
TVNAREKHDEI
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacagttctccttatctagaaacggatgtcatcattatcggtggcggagcaacc
ggtgccggaatcgctcgcgactgcgcccgccgtggtttggcttgtactttattggaaagg
catgacatcgctactggggccacggggcgtaatcatggtctcctgcacagtggcgctcgc
tatgcggtaaccgacggtgagtcagcccgtgagtgcattgaagaaaaccgcattctcaaa
cggattgctcgccactgcattgaacaaacggatggcttgttcatcaccttgccggaagac
tctctggcgtatcagctacaatttatcgcccgttgtcgggatgcgggcattgaggctgaa
gccattgatccggcacaggcactgcgcttggagcctgccgtcaaccccgcgctgattgcc
gcggtccgggtccctgatggtactgtcgatcctttccgtttaaccgcggctaacatgttg
gatgcccgcgaacatggcgcgaatattctgacatatcatgaagttatcggtttgttgcgg
cagggttcccgaatcaatggtgtgtgcgttttcgaccataaaaatcagcgaaaatacgac
attcatgcgcagattgtggtgaatgctgctgggatctggggacaacatattgctgaatat
gccgatctgcgtatccgcatgttccccgccaaaggcgcgttgctgatcctcgggcatcgg
atcaataacatggtgatcaaccgttgtcgtaagcctgcggatgccgatattttggtgccg
ggcgataccatttcattgatcggtaccacgtcaacccacatcaattacgatcaaatagac
aatatggtagtaacggcacaagaggtggatacattaattcgtgaaggtgccaaactttcg
ccgcaactggcgcaaacccgtattttgcgtgcctacgcgggagtgcggccgctggttgcc
agcgatgatgatccatcagggcgtaatgtcagccgtggcatcgtattactggatcatgcc
agccgggatggggtggagggttttatcacgatcaccggtggcaagctgatgacctaccgg
ctgatggcggaatgggcaaccgataaagtgtgcgaaaagttgggtatcagcgcagcttgt
accacagcgcaagtgccattacccggctcacggcaatccgcagaacagactttaagcaaa
gtgatctctttgcctgccagcattcgcggttcggcggtttatcgccatggtgatcgtgcc
acgcagttgttggtgggaaaccggctggataacagcctggtgtgtgaatgtgaggcggtc
accgccggtgaagttcgctacgcggttgaatctttatcggtcaataacctgttggattta
cgccgtcgtacccgtgtggggatgggcacttgccagggagaactgtgcgcttgccgtgca
gcgggcctactcagccgctttaaggtgaccacaccgcagcaatcccgtgagcaactgaca
caatttctcaacgagcgctggaaaggtgtacgcccaattgcttggggtgatgcattgcgt
gagagtgagtttacccagtgggtctatcagggactctgtggtttggatgagattccagcc
accgtgaatgcgcgggagaaacacgatgaaatttga

DBGET integrated database retrieval system