KEGG   Yersinia ruckeri Big Creek 74: UGYR_01205Help
Entry
UGYR_01205        CDS       T03887                                 

Definition
(GenBank) glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
yrb  Yersinia ruckeri Big Creek 74
Pathway
yrb00010  Glycolysis / Gluconeogenesis
yrb01100  Metabolic pathways
yrb01110  Biosynthesis of secondary metabolites
yrb01120  Microbial metabolism in diverse environments
yrb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UGYR_01205
Enzymes [BR:yrb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     UGYR_01205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AKA37139
LinkDB All DBs
Position
complement(282707..283582)
Genome map
AA seq 291 aa AA seqDB search
MNEKVFALPVVEQISPYISQRQLDDLPVVVVSHPKVKAAIALQGAHLLAWQPGSEQPIIW
LSNNTPFKAGIAIRGGIPICWPWFGPTAQPSHGFARILPWTLSAHDENDNGVMLTFTLKD
SDESRQYWPHAFTLIARFKLGEECEMELESHGDYQAAAALHTYFQIGDISQIKISGLGEK
YIDKVLKVSDATQTGDLVFNGQTDRVYTQPQACSLIKDAALQRTIEVHHRHQSDVVAWNP
GSELSCSMVDMPNDGYKTMVCVETARVSKPLVAAIDAPAHLSMTLRSHKNA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagtatttgctctgcctgttgtcgaacaaatctccccttatattagccag
cgtcaattagacgatctcccggtggtggtggtctcacacccgaaagtaaaagcagccata
gccctacaaggtgcccacctgttagcctggcagccaggcagtgaacaacccattatctgg
ctgagcaacaacacaccgtttaaagcaggcatcgccattcgcggcggcattcctatttgt
tggccttggtttggcccaacggctcaaccgtcacacggttttgcccgtattttgccgtgg
acactcagtgcccatgatgaaaacgacaacggcgtaatgcttactttcacccttaaagac
agtgatgaatcccgtcaatactggccacacgcttttaccctgattgctcgcttcaaactg
ggtgaagaatgtgaaatggagctggaatcccacggtgattatcaggcggcggccgcactg
catacctatttccaaatcggtgatatcagccagattaaaattagcggcttaggtgaaaaa
tacatcgataaggtactgaaagtgagcgatgccactcaaactggcgatttggtatttaac
ggccagaccgatcgggtttacacccaaccacaagcctgcagtctcattaaagatgctgcg
ttgcaacgtacgattgaagtccatcatcgtcatcagagtgacgttgtcgcttggaatcct
ggttctgagttatcttgcagcatggtcgatatgccgaatgatggctataagacgatggtt
tgtgttgaaactgcgcgcgtcagcaaaccactggttgctgcaatcgatgctcctgcacac
ctctccatgacccttcgcagccacaaaaacgcttaa

DBGET integrated database retrieval system