KEGG   Yersinia ruckeri Big Creek 74 (serotype O2): UGYR_02140Help
Entry
UGYR_02140        CDS       T03887                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
yrb  Yersinia ruckeri Big Creek 74 (serotype O2)
Pathway
yrb00061  Fatty acid biosynthesis
yrb00780  Biotin metabolism
yrb01100  Metabolic pathways
yrb01130  Biosynthesis of antibiotics
yrb01212  Fatty acid metabolism
Module
yrb_M00083  Fatty acid biosynthesis, elongation
yrb_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:yrb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    UGYR_02140
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    UGYR_02140
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    UGYR_02140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yrb01004]
    UGYR_02140
Enzymes [BR:yrb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     UGYR_02140
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     UGYR_02140
Lipid biosynthesis proteins [BR:yrb01004]
 Fatty acid synthase
  Component type
   UGYR_02140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF732
Motif
Other DBs
NCBI-ProteinID: AKA37310
UniProt: A0A085U7S9
LinkDB All DBs
Position
488495..489283
Genome map
AA seq 262 aa AA seqDB search
MGFLTGKRILITGVASKLSIAYGIAQAMHREGAELAFTYQNEKLKSRVEGFAAELGSNLI
LPCDVAEDASIEAMFAELGKTWPKFDGFVHSIGFAPADQLDGDYVNAVTREGFNIAHDIS
SYSFVAMAKVCRSMLNPNSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNGISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTTEDVGNSAAFLCSDLAAGV
SGEILHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctaaccggcaaacgcattctgattactggcgtagccagcaaactgtctatt
gcctacggtattgcacaagcaatgcatcgtgaaggggctgaactggctttcacctatcag
aacgaaaaattaaaatcccgcgttgaaggctttgcggccgagttgggttccaacctgatt
ctgccttgcgatgtggctgaagatgccagcatcgaggccatgtttgctgaactgggaaaa
acctggccgaagtttgatggtttcgttcactcaattggttttgccccggctgaccagtta
gatggtgattacgtcaatgcggtgacccgtgaaggcttcaatatcgcccacgacatcagc
tcttatagctttgttgccatggctaaagtctgccgttcaatgttgaaccctaattctgcc
ctgctgacgctgtcttacttgggtgcagaacgtgcgatccctaactacaacgttatgggt
ctggctaaagcctctctggaagccaacgtgcgctacatggcgaacgcgatgggtccagaa
ggtgtgcgtgttaacgggatatctgccggtccaatccggactctggccgcttctggtatc
aaagatttccgtaaaatgctggcacactgtgaagccgttaccccaattcgccgtaccgtg
accactgaagacgtcggtaactccgcagccttcctgtgctccgatctggctgcgggtgtt
tccggtgaaatcctgcatgttgacggcggcttcagcattgcagccatgaatgaactggaa
ttgaaataa

DBGET integrated database retrieval system