KEGG   Yersinia ruckeri Big Creek 74 (serotype O2): UGYR_03120Help
Entry
UGYR_03120        CDS       T03887                                 

Definition
(GenBank) cell division protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
yrb  Yersinia ruckeri Big Creek 74 (serotype O2)
Pathway
yrb00550  Peptidoglycan biosynthesis
yrb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:yrb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    UGYR_03120
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    UGYR_03120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yrb01011]
    UGYR_03120
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:yrb03036]
    UGYR_03120
Enzymes [BR:yrb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     UGYR_03120
Peptidoglycan biosynthesis and degradation proteins [BR:yrb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   UGYR_03120
Chromosome and associated proteins [BR:yrb03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    UGYR_03120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AKA37485
LinkDB All DBs
Position
complement(684205..685914)
Genome map
AA seq 569 aa AA seqDB search
MISKVNVETNNFIRWRFSLLCGCILLSLLGLLGRVAWLQVVEAESLAKEENLRSVRVMTT
PNMRGMITDRNGQPLAVSVPVDAIWADPQVVLDKGGVGKGPRWQALAQTLHQSLTEIASR
INQSPTGRFVYLARQVEPTSADYIQRLKLPGIALRAESRRFYPAGATVANLVGFTNIDDQ
GIEGIEKSFNQLLSGTAGHRVVRKDRYGHVVEDISATDSHPGQNVQLSIDERLQTEASHA
LTNAVLFNKAESGSAVLVDVNTGEVLAMANYPTYNPNNRADTPTENFRNRAISDIFEPGS
TVKPMVIMTALQRKLVKPDSVLDTHPYTLSGHQIRDVGFYPTLSLTGVLQKSSDVGVSRL
ALAMPASALLQTYGLFGLGKPTELGLTGESSGLMPQRQRWSDLDRATFSFGYGLMVTPLQ
LARVYATIGSYGIYRPLSITKVDPPVVGHRVMLAERVKEVEYMMESVALPGGGGVKAAVR
GYRVAVKTGTAKKIGPNGQYIDKYVAYTAGVAPASQPRFALVVVINNPQGGKYYGGAVAA
PVFSEIMGEILRTMNVEPDALPTQALRHS
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaaagtgaatgttgaaacaaacaattttattcgctggcgttttagtttgttg
tgcggctgtattcttttatcactattaggcttacttggtcgggtggcctggttacaggtt
gttgaggcggagtccttggcaaaggaagagaacctgcgttccgttcgagtgatgaccacg
ccgaatatgcgcggcatgataaccgatcgtaatggccagccgttggctgtcagtgtaccg
gtagatgcaatctgggccgatccccaagtggtgctggataaggggggggtgggaaagggc
ccacgttggcaagcgttagctcaaactctgcaccaatcgctgaccgaaattgccagccgg
attaatcagagccccacggggcgtttcgtttatctggccagacaagtggagccgacttct
gccgattacatccaacgcttaaaattgccgggtattgccttacgggcagagtcccgccgc
ttttatcctgcgggtgcgacggtggcaaatctggtcggttttaccaatatcgacgatcag
ggtattgaaggcatcgaaaagagttttaatcagttgctgagcggcacagcaggccatcgg
gtggtacgtaaagatcgctatggtcatgtggttgaggatatttcggccaccgacagccat
cccggccaaaatgttcaactgagcattgatgagcgtttgcagactgaggcttcccatgct
ttaactaacgcggtgttatttaacaaggctgaatcaggatcggcggtgctggtggatgtt
aatacgggggaggttttggcgatggccaattacccaacctataatccgaataatcgtgcg
gatacgccgacggagaatttccgtaatcgggcgattagcgatattttcgaacccggttca
acagttaagccgatggtgataatgacggcgctacaacgtaagttagtcaagccggacagc
gtgctggatacccatccctatactttgagtggccaccagatccgtgatgttggtttttat
ccgacgctgtcgttgaccggtgtgctgcaaaaatccagcgatgttggtgtatcccgcttg
gcactggcgatgccagcctcagcattgctgcaaacctatggattattcgggctgggaaaa
ccgacggaattggggctaaccggagaaagcagtggattgatgccgcagcgccagcgttgg
agtgatctggatcgtgccactttctcattcggctacggtttgatggttacaccactgcaa
ttggctcgggtttacgcgactataggcagttacggtatttatcgaccactatcgattacc
aaagtagatccaccggtagtcggtcatcgagtgatgctcgctgagcgggtaaaagaagtt
gaatatatgatggaaagcgtggcgttacccggcggcggcggtgtgaaggcggccgttcgc
ggctatcgcgtggcggtcaaaaccgggactgcgaagaaaattggtcctaacggacaatac
attgataaatatgtggcttataccgctggcgttgcgccagccagccagccacgttttgcg
ttggtggtggtgattaataatccgcagggagggaaatattatggcggggcggtagcggct
ccggtattcagcgagattatgggggaaatcttacgtactatgaacgttgaacccgacgct
ttacctacccaggcgctgcgacacagctaa

DBGET integrated database retrieval system