KEGG   Yersinia ruckeri Big Creek 74 (serotype O2): UGYR_04585Help
Entry
UGYR_04585        CDS       T03887                                 

Definition
(GenBank) beta-lactam-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
yrb  Yersinia ruckeri Big Creek 74 (serotype O2)
Brite
KEGG Orthology (KO) [BR:yrb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:yrb01002]
    UGYR_04585
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yrb01011]
    UGYR_04585
Enzymes [BR:yrb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     UGYR_04585
   3.4.21  Serine endopeptidases
    3.4.21.-  
     UGYR_04585
Peptidases [BR:yrb01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   UGYR_04585
Peptidoglycan biosynthesis and degradation proteins [BR:yrb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   UGYR_04585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AKA37742
UniProt: A0A0A8VII2
LinkDB All DBs
Position
976431..977576
Genome map
AA seq 381 aa AA seqDB search
METKPLKQFSSSLLVAALFALPAQSYAQAEHLAAQIVDQHAEHIFYNSGAMGMALVVIDN
NQVVNRSFGETRAGNNVRPRQDSLIRIASITKLMTSEIMVKLADEGKLKLTDPLKKYAPK
GAKVPAYNAKQPITLLSLASHTSGLPREQPGGPQKRPVFTWPTKSDRWQWLKIGKVTVPP
GVRAAYSNLAYDLLADALSKAAAKPYTTLLREKITEPLGMRNTTLTPTAEQCSRLMVGVG
SSACLSTIAAAGSGGIYSTPEDMQRWMQQFLTSQKSSPKASAKREQKMYYQRHELVSLKG
MDVPGQADALGLGWVYMAPKNGLPGIIQKTGGGGGFITYMAMIPEKNIGVFVVVTRTQLT
KFTNMSDGVNQLVANLASNSR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaaaccgttgaaacaattctcttcttccttgttggttgcggcactgttcgcc
ttacctgcacaaagttatgcgcaagccgaacatttggcagcgcaaattgtggatcagcat
gccgagcatattttttataacagtggcgcaatgggaatggcgctggtggtgatagataac
aatcaggtggttaaccgcagttttggtgaaacccgcgcaggaaataatgttcgtccgcgt
caggattcgttgattcgcattgcctctatcacgaaactgatgaccagcgaaatcatggta
aagctggctgatgaagggaaactaaagcttactgatccgctgaaaaaatacgcgccaaag
ggggctaaggttccggcttataacgcaaaacaaccgattacattactgagtttggccagt
cataccagtggattaccgcgcgaacagcccggtggtccacaaaaaagaccggtattcacc
tggccaaccaaaagcgaccgttggcaatggttgaaaatcggcaaggtcacggtgccacca
ggtgttcgtgccgcatattccaatctggcctacgacttattggccgatgccctttcaaaa
gcggcagccaaaccctataccacgctgctgcgggaaaaaatcaccgaaccattaggaatg
agaaataccacgctaacgccaacagctgaacagtgttctcgcctgatggtcggtgtcggc
agcagcgcctgcctcagcacgatagcggcggcaggcagcggcggtatttactcgacgccg
gaagatatgcaacgttggatgcaacaattccttacttcacaaaagagttcacctaaagct
tcggccaaacgggaacagaaaatgtattatcagcggcatgagttagtttcccttaaaggc
atggatgttccgggacaggccgatgccttaggtttgggttgggtctatatggcaccgaaa
aatggtttgcccggcatcatccagaaaaccggtggcggtggcggctttattacctatatg
gcgatgattccagaaaagaatatcggggtatttgtggtcgtaactcggacacaattgaca
aaatttaccaatatgagcgatggagttaaccaattagtcgccaatttggccagtaatagc
cgctaa

DBGET integrated database retrieval system