KEGG   Yersinia ruckeri Big Creek 74: UGYR_10520Help
Entry
UGYR_10520        CDS       T03887                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yrb  Yersinia ruckeri Big Creek 74
Brite
Enzymes [BR:yrb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UGYR_10520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKA38784
UniProt: A0A085U8P0
LinkDB All DBs
Position
complement(2327176..2327802)
Genome map
AA seq 208 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDQQTMEIHHTKHHQTYINNANTVLEAYPELANLSVEEVIKD
LSKVPADKRTFMRNNAGGHANHSLFWKGLALNTTLEGDLKAAIERDFGSVESFKAEFEKA
AATRFGSGWAWLVLQDGGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWNEAAKRFAEAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccttatgcttacgacgcactagaaccacattttgac
cagcagacgatggaaatccatcacactaaacatcaccagacttatatcaacaacgcgaac
accgtgttagaagcttatccagagttggctaacctgagcgttgaagaagtcatcaaagat
ctgagcaaagttcctgctgataaacgcacctttatgcgtaacaacgccggtggccatgct
aaccacagcctgttctggaaaggtctggcgctgaacaccacgctggaaggcgatctgaaa
gcggctatcgaacgcgatttcggcagcgtagaaagcttcaaagcagaattcgaaaaagcg
gctgcgacccgtttcggttctggctgggcatggttggtactgcaagatggcggcaaactg
gccgtcgtttctaccgccaaccaagacagcccgctgatgggtgaagcggtttctggcgcg
tcaggcttcccaatcgttggcctcgacgtatgggaacatgcttactacctgaaattccaa
aaccgtcgcccagactacatcaaagcattctggaacgtggttaactggaacgaagcggca
aaacgttttgctgaagcaaaaaaataa

DBGET integrated database retrieval system