KEGG   Yersinia rohdei: CH64_1619Help
Entry
CH64_1619         CDS       T03610                                 

Definition
(GenBank) hypothetical protein
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
yro  Yersinia rohdei
Pathway
yro00061  Fatty acid biosynthesis
yro00780  Biotin metabolism
yro01100  Metabolic pathways
yro01212  Fatty acid metabolism
Module
yro_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CH64_1619
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CH64_1619
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yro01004]
    CH64_1619
Enzymes [BR:yro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     CH64_1619
Lipid biosynthesis proteins [BR:yro01004]
 Fatty acid synthase
  Component type
   CH64_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AJJ10869
LinkDB All DBs
Position
complement(1794273..1795520)
Genome map
AA seq 415 aa AA seqDB search
MSSGMVATKRVVITGMSGVTAFGNNWADVSARIYAGENAVQYMPQWEEYQGLNTHLGAPI
NDFVIPAHYTRKRIRSMGRVSLLATRATELALEQAGLLGENVLTNGETGIAYGSSTGSTK
PVSEFATMLTEKHTNNITGTTYVQMMPHTAAVNTGLFFGLRGRVIPTSSACTSGSQAIGY
AYEAIRHGYQTVMVAGGAEELCPSEAAVFDTLFATSQLNDSPKLSPKPFDSQRDGLVIGE
GAGTLILEELEHATARGATIYGEIIGFYTNCDASHITQPQKETMQICIEKALLSSGLAAA
DIGYISAHGTATERGDIAESQATAAVFGNRTPISSLKSYFGHTLGACGALEAWISLEMMR
AGRFAPTINLTDPDPACGDLDYLMGEGRCIDTEFFQTNNFAFGGINTSLVIRRWP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggtatggttgccaccaaaagagttgtgattaccgggatgagcggcgtcacc
gcctttggcaataactgggctgatgtttcggcacgtatctatgccggcgaaaatgcggtg
caatatatgccgcagtgggaagagtatcaggggctgaatacccatttaggcgcaccaatt
aacgattttgtgataccggcacattacacccgcaagcgcattcgctcgatggggcgggta
tcattattggccacccgagcaactgagttggcgttggagcaggctgggttactcggtgaa
aatgtcctgaccaatggtgaaaccggaattgcttacggctcctcaaccggcagcaccaag
ccagtcagtgaatttgccaccatgttgactgaaaaacataccaataacattactggcacc
acctatgtgcaaatgatgccccatacggcggcggtgaacaccgggttattttttggtttg
cgtggtcgggttatccctacctccagtgcttgtacctcaggtagtcaggccatcggctat
gcttatgaagctattcgtcatggttatcaaactgttatggttgctggtggtgcggaagag
ctgtgcccttcagaggccgcggtgtttgataccttatttgcgaccagtcagctaaatgat
tcaccgaaattatcacctaaaccctttgatagtcagcgcgatggtttggtgatcggcgaa
ggtgccgggacacttattctggaagagttggaacatgccacagcgcgtggagccactatc
tatggtgagattattggtttctatactaattgtgatgccagccatattactcaaccacaa
aaagaaacgatgcaaatttgtattgaaaaggcattactgagctcaggtctggctgccgct
gatattggctatatcagtgcccacggcacggcaactgaacgtggcgatattgcagaaagt
caggctactgccgctgtttttggtaaccggacgccaatttcttcgttgaaaagttatttt
ggccataccttaggggcctgcggtgctcttgaagcttggatcagtttggagatgatgcga
gcagggcgttttgcccccaccattaacctgactgacccagaccccgcctgtggtgacctg
gattatctcatgggggaggggcgctgcattgataccgaattcttccaaaccaataatttc
gcctttggtggcattaatacatcattggtgatccgtcgctggccgtga

DBGET integrated database retrieval system