KEGG   Yersinia rohdei: CH64_2422Help
Entry
CH64_2422         CDS       T03610                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yro  Yersinia rohdei
Pathway
yro00564  Glycerophospholipid metabolism
yro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CH64_2422
Enzymes [BR:yro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CH64_2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AJJ09165
LinkDB All DBs
Position
2679855..2681369
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWMVEAVDANTGKTMTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDEYSIIGTTDVEYHGDPKEVKIDDQEISYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEAGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYPNIGPAWTKTGALPGGDIGGNRDTYTVQLRHRYNWLPEALARRYACT
YGSHSELILADANSIESLGEHFGHGLYEAELRYLVAKEWVVELDDAIWRRTKLGMTLDEA
QKQRVAQWLATEQAEKKQTLSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgattgtgatcggtggcggcattaatggtgccggtatcgctgca
gatgctgcagggcgtggcctgtccgttctgctgcttgaagcacaagacttggcctgtgct
acgtcttccgccagttccaaacttattcacggcggcttgcgctatttggaacattatgaa
ttccgtctggtaagcgaagcactagcagaacgtgaggttttgctgaagctggctccccat
attgccttcccaatgcgctttcgcctgccccaccagccccatctacgcccggcctggatg
attcgtaccggtttattcttatatgaccacttgggtaaacgtaccagcttgcctgccagt
aaagggctgcgttttgggccagaatctgtattgaagccggaactggtgcgcggtttcgaa
tattctgactgctgggtggatgatgcgcgcttagtggtattgaatgcccaagaagtggtc
gagcgcggtggtgaagttcgtacccgaaccaaagtgacccgcgcatggcgtgaacaaggg
ctatggatggtggaagccgttgatgcaaataccggcaaaaccatgacctggcgtgctaaa
ggtttggtcaatgcgaccggcccttgggtgaaacagttcttcgatgatggcctaaaattg
aaatcgccttatggtatccgcttgattaaaggcagccatattgtcgtcccacgggtgcat
aatcagccacaggcttacatcttgcaaaacgaagaccaccgcattgtcttcgtcattcct
tggttggacgagtattccatcattggcaccaccgacgtggaataccacggcgatccgaaa
gaggtgaagattgatgatcaggaaattagttatctgctgaaggtgtataacgaccacttt
aaaaagcagctgggccgtgatgatatcgtctggacttattcgggtgtccgtccgctgtgc
gacgatgaatcagattcaccgcaagcggtgacccgcgattacacactggatgtcgccgat
gaagcgggtaaagcgccactgttgtcagtatttggtggcaaactaaccacttatcgtaaa
ttggccgaacatgcgctggaaaaactgtctggctactatccgaatatcggcccggcgtgg
acgaaaaccggcgcattaccgggtggtgatattggtggcaaccgtgacacctataccgtg
caattacgccaccgctataactggttaccagaagccctggcgcgccgctatgcctgcact
tatggtagccacagcgagctgattttagcggatgccaacagcatcgaaagcttgggtgaa
cacttcggtcacggcttgtatgaagctgaattacgttatttggttgccaaagagtgggtt
gttgagctggatgatgccatttggcgtcgaaccaaactgggcatgactttagatgaggcg
caaaaacagcgcgttgcacagtggttagctaccgaacaagcagagaaaaaacagacactt
tctttggtttcctga

DBGET integrated database retrieval system