KEGG   Yersinia rohdei: CH64_2518Help
Entry
CH64_2518         CDS       T03610                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yro  Yersinia rohdei
Brite
Enzymes [BR:yro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH64_2518 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJJ11995
UniProt: A9U915
LinkDB All DBs
Position
2804015..2804635
Genome map
AA seq 206 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASYSVEDLIKD
LDKVPADKRTFMRNNAGGHANHSFFWKGLKLGTSLGGDLKAAIERDFGSVEKFQEEFEKA
AATRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAVSGASGFPIIGLDVWEHAYYLKFQN
RRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccttatgcttatgacgccctggaaccacatttcgat
aagcagacgatggaaatccatcacaccaaacaccaccaaacctatgtaaacaatgcaaac
acggtgttggaagcctacccggaactggcaagctatagcgttgaagatcttatcaaagat
ctggacaaagtccctgctgacaagcgcacctttatgcgcaataacgccggcggccatgct
aaccacagcttcttctggaaaggcctgaaattgggcactagccttggtggcgatctgaaa
gctgctatcgaacgcgatttcggtagcgtagagaaattccaggaagaattcgaaaaagcg
gctgcgacccgtttcggttctggttgggcttggctggtattgaaagacggcaaattggcg
gtagtttctactgctaaccaagacagcccgttgatgggtgaagcggtttctggcgcatca
ggcttcccgattattggcctggatgtttgggaacatgcttactacctgaaattccaaaac
cgccgcccagactacatcaaagcattctggaacgtagttaactgggacgaagcagcagcc
cgtttcgctcaagctaagtaa

DBGET integrated database retrieval system