KEGG   Yersinia rohdei: CH64_2859Help
Entry
CH64_2859         CDS       T03610                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
yro  Yersinia rohdei
Pathway
yro00071  Fatty acid degradation
yro00280  Valine, leucine and isoleucine degradation
yro00281  Geraniol degradation
yro00310  Lysine degradation
yro00362  Benzoate degradation
yro00380  Tryptophan metabolism
yro00410  beta-Alanine metabolism
yro00640  Propanoate metabolism
yro00650  Butanoate metabolism
yro00903  Limonene and pinene degradation
yro00930  Caprolactam degradation
yro01100  Metabolic pathways
yro01110  Biosynthesis of secondary metabolites
yro01120  Microbial metabolism in diverse environments
yro01130  Biosynthesis of antibiotics
yro01200  Carbon metabolism
yro01212  Fatty acid metabolism
Module
yro_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CH64_2859 (fadB)
   00650 Butanoate metabolism
    CH64_2859 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CH64_2859 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CH64_2859 (fadB)
   00310 Lysine degradation
    CH64_2859 (fadB)
   00380 Tryptophan metabolism
    CH64_2859 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH64_2859 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CH64_2859 (fadB)
   00281 Geraniol degradation
    CH64_2859 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CH64_2859 (fadB)
   00930 Caprolactam degradation
    CH64_2859 (fadB)
Enzymes [BR:yro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CH64_2859 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CH64_2859 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CH64_2859 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     CH64_2859 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Endotoxin_C2
Motif
Other DBs
NCBI-ProteinID: AJJ11139
LinkDB All DBs
Position
complement(3187768..3189957)
Genome map
AA seq 729 aa AA seqDB search
MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTKTVANLGEALAVLEKQNELKGLLLRSA
KAAFIVGADITEFLSLFNAPPEKLHQWLVFANDIFNRLEDLPVPTISAINGYALGGGCEC
ILATDFRVASPETRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDIIAKDALK
IGLVDAVVAPEKLADAALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEATMCFTIAKGMV
MQVAGKHYPAPLTAVKTIEAAAKLGRAEALKLETNSFVPLAGSNEARALVGIFLNDQYVK
GKAKKLAKGISAPKQAAVLGAGIMGGGIAYQSALKAVPVIMKDINEASLTLGMNEAAKLL
NKQLERGKIDGLKMANILATIQPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVETLIGE
DTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGTKTSDKTIATVVAY
ATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAVGFADRMDKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAKGKP
RKENDEQVDVLLAAVSQPRQQFSDDAIIARTMIPMINEVVRCLEEGIIASPAEGDMALVY
GLGFPPFHGGVFRYLDTIGSANYVEMAQRYVHLGALYHVPAGLRAKAEHNETYYPVAAAL
LDVSTSQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaagcgaaacactacagcttcactggttggaaaacggcattgccgagttg
gtgtttgatgcaccgggttcagtaaataaactggataccaaaactgtagccaatctgggt
gaagccctggctgtgctggaaaaacaaaacgagctcaaagggttgctgctgcgttccgcc
aaggccgcatttattgtcggtgccgatatcaccgagtttttatccctgtttaatgcgccg
ccagaaaaactgcaccaatggctggttttcgcgaacgatattttcaatcgtttggaagac
ttaccggtgccaaccatttctgccatcaatggatacgcactcggtggcgggtgtgaatgt
attttggccacggattttcgtgttgcctcaccagaaacccgtattggcttgccggaaacc
aaactcggcatcatgccaggttttggcggctcagttcgcttaccacggttattaggcgca
gacagcgcattagaaatcattgcagctggcaaagatattattgctaaagatgccctaaaa
attgggttggttgatgcggtggtcgcaccagagaaactggcagatgcggcattaactatg
ctgaaacaggccattgacggaaaacttgactggcaagccgctcgccgcccgaaattggaa
ccactcaaactcaacccaactgaagccaccatgtgctttaccattgccaaaggcatggtt
atgcaagtggccgggaagcactacccagcacctttgaccgccgttaaaaccatcgaagct
gccgcaaaattgggtcgggccgaggccctgaaactggaaactaacagtttcgtgccattg
gcgggctctaatgaagctcgtgcactggttggcattttccttaatgaccagtatgtaaaa
gggaaagcaaaaaaactcgctaaaggcataagtgcgccaaaacaagccgcagtgctgggt
gccgggattatgggcggcgggattgcctatcaatcggcactgaaagcagtaccggtcata
atgaaagatattaatgaagcatcgctgactctggggatgaatgaggcggccaagctactg
aataagcagttggaacgcggaaaaatagatggcctgaaaatggcaaatattttagcgacc
atccaaccaacactggattacgccggcattgaacgcgcacaagttattgtggaagcggtg
gtggaaaatccaaaagtgaaagccgccgtcctggcggaagtggaaacactgattggcgaa
gacacagttttagcctctaacacatcaaccattccaatcgatcaattagctaaatcactt
aaacgcccagaaaacttctgcggtatgcatttcttcaacccggtgcatcggatgccgttg
gttgaaattatccgtggtacaaaaacctcagataaaactattgctaccgtagtggcatac
gccacgcaaatgggtaaaaccccaattgtggtgaatgattgccctggcttctttgttaac
cgcgttttattcccgtatctggcagggtttggcatgttagtcagagatggcgctgatttc
cgtcaaattgataaagtgatggaaaaacaatttggctggccaatgggccctgcttatcta
ttagatgtggtgggcattgataccgcgcaccatgcacaagccgtgatggcagtgggtttc
gcagaccggatggacaaagattatcgcgatgctgttgatgttatgtttgataatcaacgg
tttggccagaaaaatggtcaaggtttctatcgttacactcaggatgccaagggcaaaccg
cgcaaagagaatgacgagcaagtcgatgtgctgctggctgctgtcagccaaccaaggcag
caattcagcgacgacgccattattgcccgcaccatgatcccaatgatcaatgaggtcgtg
cgctgtctggaagaaggcattattgccagcccggctgaaggggatatggcgctcgtttac
ggtcttggtttcccgccattccacggcggcgtcttccgctatcttgataccatcggcagt
gcaaattatgtcgaaatggcacagcgctatgtccaccttggtgcgctgtatcacgtccct
gcggggctgagagcgaaagctgaacataacgaaacttattatcccgtggcagcagcgctg
cttgatgtttctaccagtcaaccggcatga

DBGET integrated database retrieval system