KEGG   Yersinia rohdei: CH64_3133
Entry
CH64_3133         CDS       T03610                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
yro  Yersinia rohdei
Brite
KEGG Orthology (KO) [BR:yro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yro02044]
    CH64_3133
Secretion system [BR:yro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CH64_3133
SSDB
Motif
Pfam: VipB VipB_2 DUF1877
Other DBs
NCBI-ProteinID: AJJ11993
UniProt: A0A0U1HY45
LinkDB
Position
3489926..3491428
AA seq 500 aa
MSTLEAKNKSAGVATATEYSDFNSLLTKEFKAKSEQTKAAVEGAVKTLAEQALANSVTVS
DDAYKSIASIIAEIDSKLSEQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLD
ISKDELRRNMKRYKGVAWDQSPLFKKVYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLA
SIGKVAASAHVPFITGAAPSVLQMESWQELSNPRDLTKIFTQNLEYAAWNSLRQSEDSRY
IGLAMPRFLARLPYGIRTNPVDAFHFEETTDGADHSKYVWSNAAYAMAVNINRSFKEYGW
CTLIRGVESGGVVEGLPCHTFPTDDGGIDIKCPTEIAISDRREAELAKNGFIPLVHRKNT
DYAAFIGAQSLQKPAEYYDADATANANLSARLPYLFACSRFAHYLKCIVRDKIGTFKERD
EMQRWLNDWVMNYVDGDPANSSIETKARRPLAAAEVIVEDVEGNPGYYQAKFFLRPHFQL
EGLTVSLRMVAKLPSLKDVA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtctactttagaagcaaaaaataaatcagctggcgtagccaccgcaactgaatatagt
gattttaattcgctgttgaccaaagaattcaaagcgaaatctgagcaaactaaagccgca
gttgaaggtgcagttaaaaccttggcagaacaggctctggctaactccgttaccgtctct
gacgatgcgtataagagtattgcctctattatcgctgaaattgatagcaagttgtctgaa
cagattaacttgattctgcatcaccaagaattccagtctctggaaagtgcatggcgtggt
ctgcactatttagtgaataacactgagactgatgagaagttaagattgcgtttccttgac
atctctaaagatgaattgcgccgtaacatgaagcgctataaaggtgtggcttgggatcaa
agcccattattcaaaaaagtctatgaagaagagtatggccaattgggtggcgaaccttac
ggttgcctggttgcggactactacttcgatcacacggcacctgacgtagatttgctggct
tcaatcggtaaagttgctgcttctgcacacgtgccgtttattaccggtgctgcgccttct
gtactgcaaatggaatcttggcaggaactgtcaaatcctcgtgatttgaccaaaatattt
actcagaaccttgagtatgctgcatggaactcactgcgtcagtcagaagactctcgctat
attggtctggctatgccacgtttcctggctcgtctaccttacggcattcgtactaatccg
gtggatgctttccacttcgaagagacgactgacggtgctgatcatagcaaatatgtttgg
tcgaatgcggcttatgctatggctgttaacatcaaccgttcatttaaagaatacggctgg
tgtacgctgattcgtggtgtggaaagtggtggggtagttgaaggtttaccttgtcataca
ttcccgaccgatgatggcggtattgatattaagtgcccaacagaaatcgctatttctgac
cgtcgtgaagcggaactggctaaaaatggctttattccactagtgcacagaaagaatacg
gattatgcagctttcattggcgcgcaatcattgcaaaagccagcggaatattatgatgct
gatgcgactgcgaacgctaatttatctgcgcgtctgccgtacctgtttgcttgctcacgt
tttgcccattatttgaaatgtatcgtgcgtgataaaatcggtaccttcaaagagcgtgat
gaaatgcagcgttggttgaatgactgggtaatgaattatgttgatggtgacccggcaaac
tcttctatcgagacaaaagcacgtcgtcctctggctgcggctgaagttattgttgaagat
gttgaagggaacccaggctattaccaggctaagttcttcctgcgccctcacttccagttg
gaaggtttgacagtttcactgcgcatggttgctaaattaccatcgctgaaggatgttgca
taa

DBGET integrated database retrieval system