KEGG   Yersinia rohdei: CH64_3367Help
Entry
CH64_3367         CDS       T03610                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
yro  Yersinia rohdei
Brite
Enzymes [BR:yro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH64_3367 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AJJ12535
LinkDB All DBs
Position
3790638..3791162
Genome map
AA seq 174 aa AA seqDB search
MKLKYLLLPAILFSGNLLAADIIVTMNEALPAGNGKALGTVTVTETPYGLLFSPNLTGLA
AGIHGFHLHENPSCAAGQKEGKAVPALAAGGHFDPNKTGMHLGPYSDKGHLGDLPGLVVN
ADGTATYQVLAPRLRSLSELKQHALMIHAGGDNYADHPMPLGGGGARMACGVIE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaaatacttactgttaccagcaatattgttttcgggcaacttactggcagca
gatatcatcgtaaccatgaatgaggctctcccagccggcaatggtaaggcgcttggcact
gtcactgtgacagaaaccccttatggcttactgttcagccccaatctgaccgggttagcg
gcgggtattcatggcttccatctgcatgaaaatccaagctgtgcagcagggcagaaagaa
gggaaagcggttcctgcattggcggcgggggggcattttgatccgaacaaaaccggcatg
catcttgggccctatagtgataaaggccatctgggcgacttaccggggctagtggttaat
gccgacggcacggcaacctatcaggtattggccccgcgactgagatcattatcagaactt
aagcagcatgcgctaatgattcatgccggtggtgataactatgctgaccacccaatgcca
ctgggcggcggcggtgctcgcatggcctgtggtgtcattgagtaa

DBGET integrated database retrieval system