KEGG   Yersinia rohdei: CH64_361Help
Entry
CH64_361          CDS       T03610                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yro  Yersinia rohdei
Pathway
yro00250  Alanine, aspartate and glutamate metabolism
yro00410  beta-Alanine metabolism
yro00430  Taurine and hypotaurine metabolism
yro00650  Butanoate metabolism
yro01100  Metabolic pathways
yro01110  Biosynthesis of secondary metabolites
yro01120  Microbial metabolism in diverse environments
yro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CH64_361
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH64_361
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH64_361
   00430 Taurine and hypotaurine metabolism
    CH64_361
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CH64_361
Enzymes [BR:yro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CH64_361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJJ09288
LinkDB All DBs
Position
411366..412766
Genome map
AA seq 466 aa AA seqDB search
MNKTNITPTYNENDDVYGSADLASELPKSMFPTAERNPRNVFNAIRDELMLDGNSRQNLA
TFCQTWVDDEIRELMDLSIDKNMIDKDEYPQTAEIEARCVRMLADLWKSPTPDSTLGCST
IGSSEAAMLGGLALKWQWRKKRAEQGLPTDKPNLICGPVQVCWHKFARYFDVELREIPLE
GDRLIMNAEEVLKRVDENTIGVVPTLGVTFTCQYEPVKEVSDALDRLQQETGLDIPMHID
GASGAFLAPFCSPELEWDFRLPRVKSINSSGHKFGLAPLGAGWVVWREAADLPEELIFNV
NYLGGNMPTFALNFSRPGGQIVAQYYNFLRLGREGYAKIHNACYATAQHLATEIGKLGPF
EILFDGDSDKGIPALAWKLKDDSAIGGYTLYDLAEKLRARGWQVPAYSMPTHREDLVIQR
ILVRHGVSYDLGCLLIEDIKRALIEFENHPVINPVSAQVGSGFNHG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaataagacaaatattactccaacttataatgaaaatgatgatgtttatggttcagcc
gatttagcgagtgagttgccgaaatccatgttccccactgccgagcgtaatccgcgtaat
gtctttaatgccatccgcgatgaactgatgctggacggtaattcacgccagaacctggcg
acgttctgtcagacctgggtggatgacgaaattcgcgaactgatggatttgtcgatcgac
aaaaatatgatcgataaagacgaatacccacagacggctgaaattgaagcccgctgcgta
agaatgctggccgacctgtggaaatccccaacgccggatagcacccttggctgttcaacc
atcggttcttcggaggccgcgatgctgggcgggttggcgctgaagtggcagtggcgcaaa
aagcgggccgagcaggggctgcctaccgataaaccgaacctgatttgtggcccggtgcag
gtctgctggcacaagtttgctcgctacttcgacgttgaattgcgtgaaatcccgttggaa
ggcgatcgtttgatcatgaacgcggaagaagtgctcaagcgcgttgacgaaaataccatt
ggtgtcgtaccgacgctgggtgtgacattcacctgccagtatgagccggtcaaagaagtg
agtgatgcgttagaccgtctgcaacaggaaaccggtcttgatatcccgatgcatatcgat
ggggccagcggcgctttcctcgcacccttctgctcgccagaactggagtgggatttccgt
ctgcctcgggtgaagtctatcaactcatctggccataaatttgggttggccccgctgggt
gccggctgggtggtatggcgtgaggcggccgatttgcctgaagagctgattttcaacgtc
aactaccttggcgggaacatgccaaccttcgcgctgaacttctcacgccctggtggccag
attgtggcgcagtattacaacttcttgcgccttggccgtgaaggctacgccaaaatccac
aatgcttgctacgccacggctcagcatctggcgacagagattggcaagttggggccgttt
gaaattctgtttgatggcgatagtgataagggcattccggcgctggcgtggaaactaaaa
gacgattcggcgattggtggctacactctttatgatttggcggaaaaactgcgtgctcgt
ggctggcaggtcccggcatattcaatgccaacgcaccgtgaggatttggtcattcaacgc
atcctggtacgtcacggcgtgagctatgaccttggttgcctgttgatcgaagacatcaaa
agggcgctgattgaattcgagaatcacccggtcatcaacccggtgtcagcccaggtaggt
agtggcttcaatcacggctaa

DBGET integrated database retrieval system