KEGG   Yersinia rohdei: CH64_449Help
Entry
CH64_449          CDS       T03610                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
yro  Yersinia rohdei
Pathway
yro00010  Glycolysis / Gluconeogenesis
yro01100  Metabolic pathways
yro01110  Biosynthesis of secondary metabolites
yro01120  Microbial metabolism in diverse environments
yro01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CH64_449
Enzymes [BR:yro01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CH64_449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AJJ12440
UniProt: A0A0U1HWA2
LinkDB All DBs
Position
complement(504018..504893)
Genome map
AA seq 291 aa AA seqDB search
MNEKVFTLPVVEQISPYISQRQIDDLPVVVVSHPKVRAAVSLQGAHLLAFQPSGEQPVIW
LSNNTPFKEGVAIRGGVPICWPWFGPSAQPAHGFARLLSWTLSAHDENENGVMLTFTLKD
SEASRKFWPHAFTLIARFKLGDECEMELESHGDYQAVAALHTYFQIGDINQIKISGLGDK
YLDKVLKITDATQQGDLVFNGQTDRIYTQPEAYSLIKDAVLKRTIEVHHHHQSDVVAWNP
GAELSCSMVDMPNDGYKTMVCVETARVNKPLVATPDAPARLAMTIRSRKNS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagtattcaccctacctgttgttgaacaaatttcgccttacatcagccaa
cgtcagatcgacgatctgccagtggtggtggtttcccatccgaaagttcgcgccgcagta
agcttgcaaggtgcccatttgctggccttccagcctagcggtgagcaaccggttatctgg
ctaagtaataacaccccatttaaagaaggtgtggctattcgtggtggtgttcctatctgt
tggccttggtttggcccatccgcacaacctgcgcatggttttgcccgtttgctgtcatgg
actctgagcgcccatgatgagaacgaaaatggggttatgctgacctttactctgaaagac
agcgaagcatcacgtaaattctggccacatgcattcactttgattgcccgcttcaaatta
ggcgatgaatgcgaaatggaattggaatcacatggtgattatcaagccgtggcagcgttg
catacttacttccagattggcgatatcaatcagattaaaatcagtggccttggcgataaa
tacttagataaagtgctaaaaatcactgatgccactcagcaaggcgacttagtgtttaat
ggtcagactgaccgaatttatacccagccagaagcctacagcctgataaaagatgctgtg
ctgaaacgcaccattgaagtacatcatcatcatcaaagtgatgtggtggcctggaaccca
ggtgctgaactgtcttgcagtatggtcgacatgccaaatgatggctataaaacaatggtt
tgcgtggaaaccgcacgtgttaataagcctttggtcgcgacaccagatgcccctgcgcgt
cttgctatgactatccgtagccgtaagaattcctga

DBGET integrated database retrieval system