KEGG   Yersinia rohdei: CH64_472Help
Entry
CH64_472          CDS       T03610                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
yro  Yersinia rohdei
Pathway
yro00240  Pyrimidine metabolism
yro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CH64_472
Enzymes [BR:yro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CH64_472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AJJ12130
UniProt: A0A0U1HW24
LinkDB All DBs
Position
526567..527166
Genome map
AA seq 199 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFAVGTVSSRIGLSSEAL
LYNSGTSLFSIISTEHQEKPVHCILLDECQFLTKEQVLELCQVVDELHIPVLCYGLRTDF
LGELFPGSKYLLSWADKLVELKTICHCGRKANMVLRLDAQGLAMHDGEQVVIGGNESYVS
VCRRHYKEAIKAACLQRQP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattactcagctatgaatgcgggtaagtctacagcgctgttg
cagtcatcttataactaccaagagcgtggcatgcgcactttggtgtttaccgccgagatt
gataatcgctttgccgtcggaactgtcagttcacggataggactgtcttcagaagctctt
ctatacaatagtggcacatcattattctctattatcagcacagagcatcaggaaaaaccc
gtccattgtattttacttgatgaatgccaatttttgaccaaagaacaagtgctggaattg
tgccaggtggtcgatgaattgcatattcctgttctctgttatggcttgcgtactgatttt
cttggtgagttatttcccggcagtaaatatttattatcctgggctgacaagttggtcgaa
ctaaaaacgatttgccattgcggccgcaaagcaaatatggtgctgcgtttagatgcgcag
ggccttgccatgcacgatggtgaacaggtggtgattggcggcaatgaaagctatgtctct
gtttgtcgacgtcactataaagaagctattaaagcagcttgtcttcagcggcagccataa

DBGET integrated database retrieval system