KEGG   Yersinia rohdei: CH64_677
Entry
CH64_677          CDS       T03610                                 

Gene name
gstB
Definition
(GenBank) glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yro  Yersinia rohdei
Pathway
yro00480  Glutathione metabolism
yro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CH64_677 (gstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yro02000]
    CH64_677 (gstB)
Enzymes [BR:yro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CH64_677 (gstB)
Transporters [BR:yro02000]
 Other transporters
  Pores ion channels [TC:1]
   CH64_677 (gstB)
SSDB
Motif
Pfam: GST_C GST_N GST_N_2 GST_C_3 GST_N_3 GST_C_2 GST_N_5 Tom37
Other DBs
NCBI-ProteinID: AJJ09949
UniProt: A0A0U1HPX7
LinkDB
Position
758938..759546
AA seq 202 aa
MKLFYKPGACSLSPHIVLREAGLDFSIESVDLATKITETGEDYLSINPKGQVPALLLDDG
SLLTEGVAIVQYLADKVPDRHLIAPTGTLSRYHAIEWLNFVATELHKGFSPLFNPKTPEE
YKVIARERLDKQFSYVDHELSQHDYLLGKKFSVADAYLFTVTRWANALNLEITQRSHLDK
YMARVAERPAVKAALAAEDAKK
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaattgttctataaacccggtgcctgttctttatcaccgcatattgtattacgtgaa
gcaggattagacttcagtattgaaagtgtcgatctagcgactaagataactgagacgggt
gaagactatttaagcatcaatcccaaaggccaagtgccggcgttattgcttgatgatggc
agcctactgactgaaggcgttgctatcgtgcagtatctggcggataaagttccagatcgc
catctcattgcccctacgggcactctctcccgctaccatgctattgagtggttaaacttc
gttgcgactgagttacataaaggattcagcccgctatttaaccccaaaacaccggaagaa
tataaagttattgcccgtgagcggctggataaacaattcagctacgtagaccacgaatta
tcacagcatgattatctgttaggcaaaaaattcagtgtcgccgatgcttatttatttacg
gtaacccgttgggcgaatgcgctaaatctagaaatcacccagcgcagccatctggataag
tatatggcccgagttgctgaacgcccggcagtcaaagccgcgctggcagcagaagacgca
aagaaataa

DBGET integrated database retrieval system