KEGG   Yersinia rohdei: CH64_898Help
Entry
CH64_898          CDS       T03610                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
yro  Yersinia rohdei
Pathway
yro00020  Citrate cycle (TCA cycle)
yro00480  Glutathione metabolism
yro01100  Metabolic pathways
yro01110  Biosynthesis of secondary metabolites
yro01120  Microbial metabolism in diverse environments
yro01130  Biosynthesis of antibiotics
yro01200  Carbon metabolism
yro01210  2-Oxocarboxylic acid metabolism
yro01230  Biosynthesis of amino acids
Module
yro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yro_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:yro00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CH64_898 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CH64_898 (icd)
Enzymes [BR:yro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CH64_898 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AJJ12718
LinkDB All DBs
Position
complement(976070..977323)
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYKG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMDGAKLLKCSEFGDAIIQHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgattattccctttattgaaggtgacggtattggcgtc
gatgtgaccccagccatgatcaacgtggtggatgctgcggttaagaaagcctataaaggt
gagcgtaaaatctcctggatggaaatctataccggtgagaaatcaacacatgtatatggc
aaagatgtgtggctgccagaagaaacattagatctgattcgtgattaccgtgttgcaatt
aaaggcccgttgaccactcccgtcggtggtggtattcgttctctgaacgtggctttgcgt
caacagctcgacttgtatgtgtgtctgcgcccggtgcgttattatgaaggcacgccaagc
ccggtaaaacatccagaattgaccaacatggtgattttccgcgaaaacgcagaagacatc
tatgcgggtatcgaatggaaagccggttcgccagaagctgaaaaagtgattaagttcctg
cgtgaagaaatgggcgtgaagaaaattcgtttccctgaacaatgcggtattggtgtaaaa
ccttgttcagaggaagggactaaacgtctggttcgtgctgcgattgagtatgctattacc
aacgatcgtgaatcagtaactctggttcataaaggcaacattatgaaattcactgaaggc
gcatttaaagactggggttaccagttagcgcgtgaggaatttggtggtgagcttatcgat
ggcggcccttgggttaaaatcaagaacccaaatactggcaaagagattgttgttaaagat
gtcatcgctgatgccttcctgcaacaaattctgctgcgcccagctgaatatgatgttatc
gcttgtatgaatctgaatggcgattatatttctgatgctttggctgcacaggttggcggt
attggtattgcccctggtgccaacattggtgatgactgcgcattgtttgaagcaactcac
ggcacggcaccaaaatatgcaggtcaggataaagtgaaccctggttctattattctgtca
gcagaaatgatgctgcgtcatatgggctggttcgaagcggctgatttaattatcaaaggc
accgaaggcgcaattcaggccaaaaccgtgacttatgatttcgagcgcttgatggatggc
gctaaactgttgaaatgcagcgaatttggcgacgccataattcaacacatgtaa

DBGET integrated database retrieval system