KEGG   Yersinia ruckeri YRB: BD65_1827Help
Entry
BD65_1827         CDS       T03611                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
yru  Yersinia ruckeri YRB
Pathway
yru00620  Pyruvate metabolism
yru00680  Methane metabolism
yru01100  Metabolic pathways
yru01120  Microbial metabolism in diverse environments
yru01200  Carbon metabolism
Module
yru_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:yru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BD65_1827
  09102 Energy metabolism
   00680 Methane metabolism
    BD65_1827
Enzymes [BR:yru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BD65_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJI93939
LinkDB All DBs
Position
2008174..2010810
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGTLLGETIKEALGEHILDRVETIRKLSKSSRAGNEAHRQELLSTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALAQLFNRLKDKNLSNKE
MCKAVDELSIELVLTAHPTEITRRTLIHKLVEVNSCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKLRPSPIDEAKWGFAVVENSLWEGVPAFLREFNEQLENSLDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEVTRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRK
LAGGEEVLEPYRELMKRIRSQLINTQVYLEGRLKGERVLPPDDLLVSNDQLWEPLYTSYQ
SLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDAIAELTRYLGLGDYENW
SESDKQAFLIRELNSKRPLVPLKWQPSAETEEVLETCRVIAEAPEGSIAAYVISMAKVPS
DVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGVALTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAGAILEANLLPPPEPKKEWIEVMDLLS
EASCDMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRRANGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQKAIDAGKQQELATMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDQRLVDKKLWPLGKQLRDQLAADIKLVLAISNDDHLMADLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDARVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaacgtcagtatgctcggtacactactcgga
gaaaccatcaaggaagcgctgggcgagcacattcttgatcgggtagaaaccatccgtaag
ttatccaaatcttcgcgagccggtaatgaagcgcaccgtcaggagctgctgtcgacactg
caaaatctctctaacgatgagttattgcccgtggcacgtgcgtttagtcagttcctgaat
ctgaccaataccgcagaacagtaccacagcatttcgccgcatggcgaagcggcaagtaac
ccggaagccttggcccaactgtttaaccgcctgaaagataagaatctgagcaataaagag
atgtgcaaagcggtggatgagctctccatcgaactggtgctgactgctcatcctaccgag
attacccgccggactttgatccacaaactggttgaagtgaatagctgcctgagccagttg
gatcataatgacttggccgattacgaacgtaacaagatcatgcgtcgtttgcggcagtta
gtcgcacaatcctggcatactgacgaaattcgcaaactacgtccttcgccaatcgatgaa
gccaaatggggttttgccgtagtagaaaacagcctatgggaaggggttccggcttttcta
cgcgaatttaacgagcagttggaaaactctctcgattaccgtctaccggttgaagcagtg
ccaattcgcttcacctcatggatgggcggtgaccgtgacggcaaccctaacgttactgcg
gaagtgactcgccatgtgttgttgttaagtcgctggaaagcgaccgatctgttcctacgg
gatattcaggtgctggtatccgaactgtcgatgtcggaatgtaccccagaattacgcaaa
ctggctggcggcgaagaagtgctggaaccttaccgcgaactgatgaaacgcatccgtagc
cagctaatcaatacgcaggtctatctggaaggtcgcctgaaaggcgaacgagtgttacca
ccagatgacctgctggtcagcaatgaccaactatgggaaccgctgtacaccagctatcaa
tctctgaaagcctgtggaatggaaattatcgccaacggccaattgttggatactctacgc
cgcgtgcgttgcttcggtgtgccgttggtgcgtatcgatgttcgtcaggaaagtacccgc
cataccgatgccattgccgaactgacccgctatttgggcttgggcgactacgaaaactgg
tctgaatcagacaaacaagctttcctgattcgcgaactcaactccaaacgcccgttagta
ccattaaaatggcaacccagcgccgaaaccgaggaagtgctggaaacctgtcgggtgatt
gccgaagcgccagaaggctcaattgccgcttacgtgatttcgatggcaaaagtcccttcc
gatgtgttggcggtacatttgttactgaaagaggctggctgcccgttcaccttgccagtc
gcgccactgtttgaaactctcgatgacctgaacaacgccgatgatgtcatgacgcaatta
ttgaacattgactggtatcgtggcctgattcaaggcaaacagatggttatgatcggttat
tccgattcggcaaaagatgcgggtgttatggcggcatcatgggcgcaatatcgcgcacaa
gatgccttaatcaagacctgtgaaaaagccggtgtagctttgacgctgttccacggtcgt
ggtggttccattggtcgcggtggtgcgccagctcatgcggcgttactttctcagcctccg
ggtagcctgaaaggtggcctgcgtgtcaccgaacaaggtgagatgattcgctttaaattt
ggtctacctgaagtcaccatcagcagtctggcgctgtatgccggtgcgattctggaagcc
aatctgttgccgccaccagaaccgaagaaagagtggatcgaagtcatggatctgctgtct
gaagcctcttgcgatatgtatcgtggctacgtgcgtgaaaatcctgactttgtgccttac
ttccgcgcagcgacgccggaattggaactgggcaaattgccgttgggttcacgcccagcc
aaacgtcgcgctaacggtggagtggaaagtctacgcgctattccgtggatctttgcctgg
acccaaaaccgcctgatgctaccggcttggctgggtgctggtgccggtttgcaaaaagcc
atagatgcggggaaacagcaggaattggcaaccatgtgccgcgattggccgttcttctcg
acccgaattggtatgctggaaatggtgttcgccaaagccgatctctggttagccgaatat
tatgaccaacgtctggtagacaaaaaactttggccactgggcaaacagctacgcgaccaa
ttagccgccgatattaagctggtactggctatttccaacgacgaccatctgatggccgat
ctgccgtggattgccgagtctatcgccctgcgtaacgtttataccgatccgttaaacgtt
ctacaggccgagttattgcaccgctctcgtcagcaggaacatccggatgctcgcgttgaa
caagcattgatggtcaccatcgccggtgtagcggcaggaatgcgtaataccggttag

DBGET integrated database retrieval system