KEGG   Yersinia ruckeri YRB: BD65_2204Help
Entry
BD65_2204         CDS       T03611                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
yru  Yersinia ruckeri YRB
Brite
KEGG Orthology (KO) [BR:yru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:yru03012]
    BD65_2204 (tuf)
   03029 Mitochondrial biogenesis [BR:yru03029]
    BD65_2204 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:yru04147]
    BD65_2204 (tuf)
Translation factors [BR:yru03012]
 Eukaryotic Type
  Elongation factors
   BD65_2204 (tuf)
 Prokaryotic Type
   BD65_2204 (tuf)
Mitochondrial biogenesis [BR:yru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BD65_2204 (tuf)
Exosome [BR:yru04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BD65_2204 (tuf)
  Exosomal proteins of breast cancer cells
   BD65_2204 (tuf)
  Exosomal proteins of colorectal cancer cells
   BD65_2204 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: AJI94236
UniProt: A0A085U6V9
LinkDB All DBs
Position
2429943..2431127
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITSVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYMIVFMNKCDMVDDEELLELVEMEVRELLSAYDFPGDDIPVVRGSALKALE
GEAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIK
PHTTFDSEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNINMK
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtaccaaaccccatgtaaacgtcggtactatcggccac
gttgaccatggtaaaactaccctgactgcagcaatcacttccgtactggctaaaacctac
ggcggtaacgctcgtgcattcgaccagatcgataacgctccggaagaaaaagctcgtggt
atcaccatcaacacttctcacgttgaatatgacaccccgtctcgccattacgcgcacgtt
gactgcccaggtcacgccgactacgttaaaaacatgatcaccggtgctgcgcagatggat
ggcgcgatcctggttgttgctgcaactgatggccctatgccacagactcgtgagcacatc
ctgttgggtcgccaggttggcgttccttacatgatcgtattcatgaacaaatgcgacatg
gttgacgatgaagagctgctggaactggtagaaatggaagttcgtgaacttctttctgct
tatgatttcccaggcgacgatatcccagtagttcgtggttcagcgctgaaagcactggaa
ggcgaagctgagtgggaagctaaaatcatcgaactggctggcttcctggattcttatatc
ccagaaccagaacgtgctatcgataagccattcctgctgccaatcgaagacgtattctct
atctctggccgtggtactgtagtaactggtcgtgtagagcgcggtatcgttaaagttggt
gaagaagtagagatcgttggtatcaaagatactgttaaatctacttgtactggcgttgaa
atgttccgcaaattgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtattaaacgtgaagatatcgaacgtggtcaggttctggctaaaccaggttctatcaaa
ccacacactacctttgattcagaagtttatattctgagcaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
actatcgaactgccagaaggcgttgagatggtaatgccaggtgacaacatcaacatgaaa
gttaccttgatccacccaatcgcgatggacgacggcctgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgctggtgttgttgctaaagtaatcgcttaa

DBGET integrated database retrieval system