KEGG   Yersinia ruckeri YRB: BD65_2788Help
Entry
BD65_2788         CDS       T03611                                 

Definition
(GenBank) exonuclease SbcC family protein
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
yru  Yersinia ruckeri YRB
Brite
KEGG Orthology (KO) [BR:yru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:yru03400]
    BD65_2788
DNA repair and recombination proteins [BR:yru03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BD65_2788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SbcCD_C SMC_N AAA_29 ABC_tran cobW TsaE RsgA_GTPase GTP_EFTU
Motif
Other DBs
NCBI-ProteinID: AJI94257
LinkDB All DBs
Position
complement(3071014..3074697)
Genome map
AA seq 1227 aa AA seqDB search
MKILSLRLKNINSLQGEWKIDFTAEPFASNGLFAITGSTGAGKTTLLDAICLALYHQTPR
IKVSPSQNELMTRHTAESLAEVEFEVKGVSYRAFWSQRRAKNSPEGNLQAPKVELALCQD
GTILADKVGDKLSQIAAITGLDFGRFTKSMMLSQGQFAAFLNADANDRAELLEELTGTEI
YGRLSEQVFEQHKQAKTELDTLYLRANGIELLNEDQRQTLQSELDALHQQEQQFGAELLA
LQHQIAWITSLQQQQQHIQQCNQQRQQVELEYQQAEPDLLRLARSEPAEKLRPLQIARNQ
CLQDLQQTQQRIAEITQQQQQYQFRLTPLTLAFEQATKARQQHTAVQDEQEKIIEQQIIP
LDNQIDNQKKLLAQLDLQLQQLQAKTQQDTQQFEQDEQRLQTIHQRLRQLTDYAISHTHH
QQWEKNLPLWREQFHQLHLQRQLLADGTQQLQQKITLIDTQQQQITVLNQQEKQQQTTLV
EAEKLAGNIQQQLLLLEQQSPQAPLRQRLGELNEQRRSRLELAKLSPLAQQIQARHDQQR
QQFSTQQQQLDVLKQQLEEKRQQYQQQKQHLTDLEALYEREKQIVTLEAERTRLQAGQSC
PLCGALEHPAIAEYQALKPSETALRVAALRKQVEALYTAGSELRAQSESLRQNQARLDQE
LQQSSQLLADYQQTWQALTQPLALTFQLNEPILLTTWLEQQEQQEQDCQRKLAEYEHLQQ
QSQQAKNTLTLAEQSQQKNRQDITLLQQRLSDTQQAHKELQQSYQRQQGEFKARQQAFID
ALAKLGLQLPAPEQQQNWLNQRESEWQRWQQHQQEQQDLVLRQKMLETRLESQRSHLQEA
NEQLAELTRQHQQIGDDLKQQIKHRQSLFGDRMVAEVRQTLRQQQQQLELAQQKAADELQ
QWQSQLSRLSGELAMLDQQLQQYQLRASASQTALQQALANSEFSDEQTLTAALLSDDERQ
RLQQWQQQLSQRRQQADIRQQQASEALARHIQTCPSGIDQHTDLADLQQRSDQLSTQRKT
STLRQGELRNQLESDAIRRVTQSALFDKIENSQQQYDDWSYLNHLIGSKEGDKFRKFAQG
LTLDHLVYLANNQLTRLHGRYLLQRKTNDALELLVVDTWQADAIRDTRTLSGGESFLVSL
SLALALSDLVSHKTSIDSLFLDEGFGTLDAETLDTALDALDSLNATGKTIGVISHVEAMK
ERIPVQIKVKKINGLGISRLDSIFAVN
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttaagtttacgcctaaaaaacattaactcgctacaaggcgaatggaagatt
gattttaccgctgagcccttcgccagcaatggtctgtttgccattactggctcgactggc
gcaggaaaaaccacactgctggatgctatctgtttagcgttatatcaccaaactccgcgg
ataaaagtttcacccagccagaatgaattgatgacccgtcacactgcagaatcgctggct
gaagtcgaatttgaggtaaagggtgttagctatcgcgcattctggagccagcggcgagcc
aaaaactcacccgagggcaacttgcaggcacctaaagtcgaactggctttgtgccaagat
ggcactattctggccgataaagtgggagacaaactctcgcagatagctgctatcaccgga
ttggattttggtcgatttaccaaatcgatgatgctatcccaaggtcagttcgccgccttc
ctgaacgctgatgccaacgatcgcgcagagttattggaagagttaaccggaactgaaata
tacgggcggctatcagaacaggtttttgagcagcacaaacaggctaaaaccgaattggat
acactgtatcttcgcgccaacggcatcgaattgctcaatgaagatcagcgacaaacatta
cagtcagaactcgacgcactgcaccaacaagaacagcagttcggcgctgaactactcgct
ttacaacatcagatcgcctggatcacgtccttgcagcaacaacagcaacatatacagcaa
tgtaaccagcaacgacagcaagttgaactggaatatcagcaagcagaacctgacctgcta
cggctggcgcgcagtgaacccgctgaaaaactgcgccctttgcaaatcgcgcggaatcag
tgcttgcaagacctgcaacaaacgcaacaacgcatagcagaaataacgcaacaacagcag
caataccaattccggcttacgccgctgacgctggcttttgaacaagcgaccaaggctcgc
caacaacatactgcagtgcaagacgaacaagaaaaaatcatagaacaacagattattcct
ctggataatcagatagataaccagaaaaaactgttggctcaactggatctacagttgcaa
caattgcaggccaaaacacagcaagatacccagcagttcgagcaagacgaacagcggtta
caaacaatacatcagcggttacggcagttgactgactatgccatcagtcacactcatcat
cagcaatgggaaaagaacctgccgctgtggcgggagcaattccaccaactgcatctgcaa
aggcaattactcgccgatggcacgcaacagttgcagcaaaaaatcacactaattgacact
caacaacagcaaatcaccgtacttaaccagcaagaaaaacagcaacaaacaaccttggtc
gaagcggaaaaactggcaggcaatattcaacaacaactattactacttgagcaacagtct
ccacaagctccattgcgccaacgacttggcgagctgaatgaacagcgaagaagtcgacta
gaacttgccaaattatcgccgctggctcaacaaatacaggctaggcatgatcaacagcga
caacagttctctactcaacaacagcaacttgatgttcttaaacagcagcttgaagaaaaa
cggcagcagtaccaacagcagaaacagcatcttacggatctagaagcattgtacgagcgt
gagaagcagatcgtgacgctggaagccgaaagaacccgattacaggcaggccaatcctgc
ccactgtgtggcgcactggaacaccccgcgattgcggaatatcaggcactcaagccgtcc
gaaacagcgctacgcgttgctgccctgcgtaagcaagttgaagctctgtacactgctggt
agcgagttacgcgcccagtcagaaagcttgcggcaaaatcaggcgcgtctggatcaggaa
ctacagcaaagcagtcagttacttgctgattatcagcagacctggcaagcactgacacag
ccgctggcgctaacattccagctcaatgagccgatcttgctgactacctggctggaacaa
caagaacaacaagagcaggattgtcagcggaaactggcagagtatgagcacctgcagcaa
cagagccaacaggctaaaaatacattaaccctggcagagcaaagccaacagaaaaaccga
caggacatcaccctactgcaacagcgactatcggatactcagcaagcccacaaagagttg
caacagtcctatcaacgccagcagggtgaattcaaagcacggcaacaggctttcattgat
gcattagccaaactgggactccagttaccggctccagagcagcaacaaaattggttgaat
caacgggaaagtgaatggcagcgttggcaacagcaccaacaggaacaacaggatttggtt
ctacgacaaaaaatgctggagacccgccttgaaagtcaacgtagccatttacaggaagct
aacgagcagctagccgaactgactcgacaacatcagcagattggcgatgacttaaagcaa
cagattaaacaccggcagtctctatttggtgaccgaatggttgccgaagtgcgccagact
ttgcgtcaacaacaacagcaactggaactggcgcagcagaaagccgctgatgagttacaa
caatggcaatcgcagctaagccgtctttccggtgaactggcgatgctggatcaacagtta
cagcaatatcagttgcgggcgtctgcctctcaaacggcattgcaacaagcattggcaaac
agtgaatttagtgacgaacagacactgacagcggcattattaagtgacgatgaaagacag
cgcttacagcagtggcaacaacaattgagccaacgtcgacaacaagcagatatccgtcaa
caacaagcgagtgaagcgctggcacgacatatacagacttgcccatcggggattgatcag
cataccgatttagccgatctgcaacaacgatcagatcagctatctacccaaagaaagacc
agtacgctacgacagggagaattgcgtaatcaattagagagcgacgccattcgtcgggta
acccagtcggcattgtttgataaaatagaaaatagtcagcaacaatacgatgattggagt
tatctcaatcacttaatcggttcaaaagaaggcgataaattccgcaaatttgcacaaggt
ctaacgctcgatcacctggtttatctggccaataaccagttaacacggctacacggacgc
tatctactacaacgcaagaccaatgatgcactggaactcttggtggttgatacctggcag
gctgatgccattcgggatacccgaacgctttcgggaggagaaagtttcctggtcagccta
tcgctggcactagcactgtcggatctggttagtcataaaaccagtattgactcattgttc
cttgatgaaggttttggaacgcttgatgcggaaacactggatacggctctggatgcgctg
gacagtctgaacgctaccgggaaaactattggtgtgatcagtcatgtggaggcaatgaaa
gaacgaataccagtacaaattaaagtgaagaaaattaacggattgggcattagtcggctg
gacagtatttttgctgtaaattaa

DBGET integrated database retrieval system