KEGG   Yersinia ruckeri YRB: BD65_3186Help
Entry
BD65_3186         CDS       T03611                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
yru  Yersinia ruckeri YRB
Pathway
yru00550  Peptidoglycan biosynthesis
yru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yru00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BD65_3186
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:yru01002]
    BD65_3186
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yru01011]
    BD65_3186
Enzymes [BR:yru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BD65_3186
Peptidases [BR:yru01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BD65_3186
Peptidoglycan biosynthesis and degradation proteins [BR:yru01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BD65_3186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AJI96023
LinkDB All DBs
Position
3504234..3505439
Genome map
AA seq 401 aa AA seqDB search
MMKYTISSKLKNVTFSAGLLLLTMPAVRAADEQPAPPIDAKAYVLMDFNSGKILTQGNAD
QRLDPASLTKIMSSYVIGQAIKAGKVHPDDMVTVGKDAWATGNPVLRGSSLMFLKPGDQV
KLLDLNKGIVIQSGNDASIALADYIAGSQDSFVGLMNNYAKALGLDNTHFLTVHGLDAEG
QYSTARDMAVLAQALIRDVPEEYALHKEKEFTFNNIRQINRNRLLWNTNLNVDGVKTGHT
AGAGHNLVASATDGPMRLISVVLGAPSDRVRFSESEKLLSWGFRFYETVVPIKTDKAFVT
QKVWFGDTGKVDLGVAQNAAITIPKGQMKNLKASYKLDSTELRAPLAKHQKVGVIDFQLN
GKSIEQRPLVVMSEVKEGGFFSRMWDFVMIKLSQWFGGIFA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatatacaatctcctccaagctaaaaaatgtcactttcagtgccggtttattg
ctattgacgatgcctgccgtcagagcggcagacgagcaaccggcgcctcctattgatgcc
aaagcttatgtcttgatggactttaacagtggcaagatactgacgcagggtaacgccgat
cagcgtctggatccggcgagtctgacaaaaatcatgtccagttatgtgattggtcaggcg
atcaaagctggcaaagttcatcctgacgacatggttacggtaggtaaagatgcctgggcg
accggtaacccggtgctgcgtggttcgtcattaatgtttttgaaaccgggtgatcaggta
aaacttctggatctgaataaaggtattgttattcagtcaggtaatgatgccagcatcgcg
ttggctgattatattgccggtagtcaggacagttttgtggggctgatgaacaactatgcg
aaagcgctggggttggataatactcacttcctgacggtacatggcctggatgctgaaggg
caatatagcacggcgcgtgatatggcggtgctggcgcaggctttgattcgcgatgtaccg
gaagaatatgcattacataaagagaaagagtttacttttaacaatatccgccagataaac
cgtaaccgcctgttatggaatactaatctcaatgtcgatggggtaaaaaccggccatacc
gccggagctggacataatctggtggcatcggctaccgatggtccaatgcgtttgatttcc
gtggttttgggggcaccgagcgatcgagttcgttttagtgagagtgagaagctattgagc
tggggattccgtttttatgaaacggttgtgccaattaaaaccgataaggcatttgttacg
cagaaagtctggtttggcgataccggaaaggtggatttaggtgttgctcagaatgcggct
attaccattcccaaagggcaaatgaaaaacctgaaagccagctacaaactggactcaacc
gagttgcgagcaccattagccaaacatcagaaagtgggtgtcatcgattttcagttgaat
ggtaaaagtattgaacagcgtccgctggtggtgatgagcgaagtgaaagagggcggtttc
ttcagccgtatgtgggatttcgtgatgataaaattaagtcaatggtttggcggtattttc
gcttag

DBGET integrated database retrieval system