KEGG   Yersinia ruckeri YRB: BD65_423Help
Entry
BD65_423          CDS       T03611                                 

Gene name
gstB
Definition
(GenBank) glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yru  Yersinia ruckeri YRB
Pathway
yru00480  Glutathione metabolism
yru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yru00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BD65_423 (gstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yru02000]
    BD65_423 (gstB)
Enzymes [BR:yru01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BD65_423 (gstB)
Transporters [BR:yru02000]
 Other transporters
  Pores ion channels [TC:1]
   BD65_423 (gstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AJI93880
LinkDB All DBs
Position
470239..470844
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLSPHIVLRETGLDFSVERVDLATKKTEHGDDFLAINPKGQVPALVLDDG
SLLTEGVAIVQYLADQVPSRNLIAPAGTLARYHAIEWLNYIATELHKGFSPLFNPKTPDE
YKTIARERLDQQFIYVDGVLSQQHFLLGDKFSVADAYLFTILGWAKAMQFDLPQYKNLTA
YINRVAARPAVDGALVAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttttttataagcccggcgcctgttccctttcacctcatatcgttctacgtgaa
accggattggatttcagcgttgaacgcgttgatttggcgacaaagaaaactgaacacggc
gatgacttcttagccatcaatccgaaaggccaggttccagcattggtgctggatgatggt
agcctgttaactgaaggcgtagccattgtgcaatatttggcagaccaggttccatcccgt
aatctgattgcccccgccggtacactggcacgttatcacgctattgaatggttgaactat
attgccaccgagttacataaagggttcagcccattattcaacccgaaaacccccgacgaa
tataaaaccatcgctcgcgaacgtttagaccagcaatttatttatgtcgatggtgtgtta
agccaacagcacttcctgctaggtgacaaattcagcgtagccgatgcctatctgtttact
attctcggttgggccaaagccatgcagttcgatctaccacaatataaaaacctgacggcc
tacataaatcgagttgcggcgcgtcctgcggtagatggcgcattggttgcggaaggtttg
aaataa

DBGET integrated database retrieval system