KEGG   Yersinia ruckeri YRB: BD65_600Help
Entry
BD65_600          CDS       T03611                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
yru  Yersinia ruckeri YRB
Pathway
yru00473  D-Alanine metabolism
yru00550  Peptidoglycan biosynthesis
yru01100  Metabolic pathways
yru01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:yru00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BD65_600
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BD65_600
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BD65_600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yru01011]
    BD65_600
Enzymes [BR:yru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BD65_600
Peptidoglycan biosynthesis and degradation proteins [BR:yru01011]
 Precursor biosynthesis
  Amino acid ligase
   BD65_600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AJI94135
LinkDB All DBs
Position
complement(646971..648077)
Genome map
AA seq 368 aa AA seqDB search
MTKIRVGVIFGGKSAEHEVSLQSAKNIVDAIDTEKFEVTLLGIDKQGQWHVNDASSYLLH
AENPALIALNHSNKNVALVPGQQQRQLIDANNASALSQLDVVFPIVHGTLGEDGSLQGLL
RMANMPFVGSGVVGSAASMDKDVTKRLLRDAGLNIAPFITLTRANREQYGFEAVREKLGL
PLFIKPANQGSSVGVSKVRSAEEFTAAVELAFSFDHKVLVESAIVGREIECAVLGNDQPK
ASLCGEVVISDEFYSYDTKYISDSGAQVVIPAVLDVQVSDKIRAVAVQAFRTLECLGMAR
IDVFLTPDNKIIINEINTLPGFTNISMYPKLWRATGIDSTELITILIELALERHQQDLAL
KSSIFLNG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaaaatacgggtgggtgtgatttttggtggtaaatcggctgaacacgaagtgtca
ttacaatcggcaaagaatatcgttgatgcgatcgatacggaaaagtttgaagtcaccttg
ttagggattgataaacaaggccagtggcacgtcaatgatgcgtccagctatcttttacac
gcggaaaaccccgcgctgattgcgcttaatcattccaataaaaatgttgctttagtgccg
ggccagcaacagcgacaactgattgatgcgaacaatgcatcggcattgtcgcagttggac
gttgttttcccgattgtgcatggcacattaggtgaagacggatcgctgcaagggctattg
cggatggcgaacatgccttttgtcggttcgggagtggttggttcggcggctagtatggat
aaagatgttaccaaacgcttgctccgggatgccgggttgaatatcgcgccttttatcacg
ctgacccgcgccaatcgtgagcaatatggttttgaggcagtgcgagaaaaactgggttta
ccgctgtttatcaaaccggccaaccaaggttcttccgttggtgtaagtaaggtgcgcagt
gcggaggagtttaccgctgctgttgaactggcattcagctttgaccataaagttctggtt
gagtcagccattgtaggtcgtgaaatcgagtgtgcggttttgggtaacgatcagccgaaa
gccagcctatgcggtgaagtcgtgattagcgatgaattttactcttacgatacgaaatat
atcagtgatagtggtgcgcaggttgttattccagcggtgcttgatgtgcaggttagcgat
aagattcgggcggttgcggtgcaggccttccgtacgctggaatgcttgggtatggcgcgg
attgatgttttcctaaccccagataataaaattattatcaatgaaataaatacactacct
ggttttaccaatatcagtatgtatccgaaactgtggcgcgcgactggtattgattctact
gagttgatcacgatcttgatcgagctggcgctggagcggcatcagcaggatctggcatta
aaaagctcgatctttttgaacggctaa

DBGET integrated database retrieval system