KEGG   Yersinia ruckeri YRB: BD65_890Help
Entry
BD65_890          CDS       T03611                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
yru  Yersinia ruckeri YRB
Pathway
yru00061  Fatty acid biosynthesis
yru00780  Biotin metabolism
yru01100  Metabolic pathways
yru01212  Fatty acid metabolism
Module
yru_M00083  Fatty acid biosynthesis, elongation
yru_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:yru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BD65_890 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BD65_890 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yru01004]
    BD65_890 (fabB)
Enzymes [BR:yru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     BD65_890 (fabB)
Lipid biosynthesis proteins [BR:yru01004]
 Fatty acid synthase
  Component type
   BD65_890 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AJI94260
UniProt: A0A085U505
LinkDB All DBs
Position
complement(971799..973016)
Genome map
AA seq 405 aa AA seqDB search
MKRAVITGLGIVSSIGNNQQEVLAALQEGRSGITFAQEFKDAGMRSHIWGDVKDLDVTSR
IDRKVLRFMSDASVYAYLAMQEAIEDSKLADDQVSNFRSGLVVGSGGGSPRNQVAGSDGM
RAKGLRGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHAVELIQLGK
QDVVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDKDRDGFVIAGGGGMVVVE
ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMQGVDTPIDYMNVHGTS
TPVGDVKELGAIREIFGDNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPSINI
ETLDEKAEGMNIITEPTKRELTTVMSNSFGFGGTNATLVMRKYQK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgcagtgattactggcctaggcatcgtctctagcattggtaacaatcagcag
gaggtcctggcagctctgcaggaaggtcgttctggtattactttcgctcaggaatttaaa
gacgcgggtatgcgtagccatatctggggcgatgtgaaagacttggacgttacgtctcga
atcgaccgcaaagtgctgcgttttatgagcgatgcctctgtttatgcttatctggctatg
caagaagcgattgaagattccaaattggctgacgatcaggtatccaatttccgcagtggt
ttggttgtcggttctggcggtggttcaccgcgcaatcaggttgctggctctgatgggatg
cgtgcgaaaggtttgagaggcgttggcccttacatggtgaccaaagcgatggcatccggt
gtttccgcatgcctggctacgccgttcaaaatcaaaggcgtgaactattctatcagctcc
gcctgtgcaacatcggcacattgtatcggccatgcggttgaactgattcagttaggtaag
caggacgtggtgtttgctggtggcggcgaagaattgtgctgggaaatggcctgcgaattc
gacgcgatgggcgcactgtctaccaaatacaacgatacgccagaaaaagcttcccgtact
tacgataaagaccgtgacggttttgttatcgccggcggtggcggcatggtggttgtggaa
gaactggaacatgcattggcgcgcggcgcacatatttacgctgagatcgtaggctacggc
gcgacttcagacggtgctgacatggttgctccatccggtgaaggtgctgtgcgttgtatg
cagatggcgatgcagggtgttgatacgccaatcgattatatgaacgtacacggtacttct
acgccagttggcgatgtaaaagaactgggcgctatccgtgaaattttcggtgataacacg
ccagcgatttcttctaccaaagcgatgaccggtcactcgttgggtgctgctggtgttcat
gaagccatctttagcttgctgatggttgagcacggttttattgcgccaagcatcaatatt
gagacgctggacgagaaagccgaagggatgaatatcatcaccgaaccgaccaagcgcgaa
ctgacgacagtgatgtctaacagctttggtttcggtggtaccaatgcgactctggtgatg
cgtaaataccagaaataa

DBGET integrated database retrieval system