KEGG   Yersinia ruckeri YRB: BD65_900Help
Entry
BD65_900          CDS       T03611                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
yru  Yersinia ruckeri YRB
Pathway
yru00071  Fatty acid degradation
yru00280  Valine, leucine and isoleucine degradation
yru00281  Geraniol degradation
yru00310  Lysine degradation
yru00362  Benzoate degradation
yru00380  Tryptophan metabolism
yru00410  beta-Alanine metabolism
yru00640  Propanoate metabolism
yru00650  Butanoate metabolism
yru00903  Limonene and pinene degradation
yru00930  Caprolactam degradation
yru01100  Metabolic pathways
yru01110  Biosynthesis of secondary metabolites
yru01120  Microbial metabolism in diverse environments
yru01130  Biosynthesis of antibiotics
yru01200  Carbon metabolism
yru01212  Fatty acid metabolism
Module
yru_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BD65_900 (fadJ)
   00650 Butanoate metabolism
    BD65_900 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BD65_900 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BD65_900 (fadJ)
   00310 Lysine degradation
    BD65_900 (fadJ)
   00380 Tryptophan metabolism
    BD65_900 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BD65_900 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BD65_900 (fadJ)
   00281 Geraniol degradation
    BD65_900 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BD65_900 (fadJ)
   00930 Caprolactam degradation
    BD65_900 (fadJ)
Enzymes [BR:yru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BD65_900 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BD65_900 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BD65_900 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AJI95507
LinkDB All DBs
Position
complement(981801..984005)
Genome map
AA seq 734 aa AA seqDB search
MEKSAEQQITASVSPVESVFQLSIRPDNIGVITINVHHEKVNTLKAEFAEQIAEVLQQAQ
ALPQLQGLVMISGKPDSFIAGADITMIAACRTAQEARILAQKGQATLAKIASFPIPIVAA
IHGACLGGGLELALACHGRVCSLDDKTVLGLPEVQLGLLPGSGGTQRLPRLIGASKALDM
MLTGRQVRARQAVKMGLVDEAVARDILLDVAVSRAKAGWGDKPTLPWQERLLNGPLGKTL
LFNIVRKKALAKTQGHYPAAERIINVVRQGLDHGGARGYEAEARAFGELAMSPESAALRS
LFFATTSLKKESGSTARPHTVSRVGVLGGGLMGGGIANVTATRAGLPVRIKDINLQGINQ
ALKYTWDALGKRVRSKRLRPAERQRQMMLISGTTDYSGFDHVDIVIEAVFEDLALKQKMV
AEIEANTAAHCIFASNTSSLPISQIAAGAHRPEQIIGLHYFSPVDKMPLVEVIPHAGTSE
ETIATTVALAQKQGKTAIVVGDRAGFYVNRILAPYINEGALCLLDAEPIESIDKALVDFG
FPVGPLTLLDEVGIDVGTKIMPILVEQLGSRFAAPSSLDAILKDGRKGRKNGRGFYLYPA
KSSRFTLKKTPARQADSHIYGLLGITAKAHLQHKVIAQRCVMMMLNEAVRCLDESIIRCP
RDGDIGAVFGIGFPPFLGGPFRYLDRLGADTAVKALRLLEQQYGERFTPCERLIDMAAQG
AKFYPDDTLDMVEL
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagcgcagaacagcagattaccgcgagcgtttctccggttgaatcggtattt
cagttgagtattcggccagacaatattggcgtgatcaccattaacgttcaccatgaaaaa
gtgaataccttaaaggctgaatttgctgagcaaatcgctgaagttttgcaacaagcgcag
gctttgccgcagttacaaggcttggtgatgatttcgggtaaaccggattcatttattgcc
ggtgccgatattaccatgatagccgcctgccgcacggcgcaggaggcacgaattttggcg
caaaaagggcaggcgacgctggccaagatcgccagtttccctatcccgatagtggcggct
atccacggcgcttgcctgggcggcggtctggagctggctctagcttgtcatggtcgtgtg
tgctcactggacgataaaaccgtgctggggctacctgaagtgcaactggggctgttgccc
ggctctggcggtacgcagcgcctgccacgtttgattggtgccagtaaagcgctggatatg
atgttgaccggtcgacaggtgcgcgcgcgccaagccgtaaaaatggggctggtggatgag
gctgttgcgcgggatatcttgctggacgttgccgtcagtcgtgccaaagccggttggggg
gataaacctactctgccgtggcaggagcgtctactgaatggtccgctaggaaaaacactg
ttattcaatatagtacgcaaaaaagccttagcaaaaactcaaggtcactatccggcggca
gaacgtattatcaacgtcgttcgtcagggattggatcacggtggggcacggggttacgag
gctgaagcccgtgcttttggcgaactggcgatgtcgccggagtcggcggcgttacgcagt
ctgttctttgctactacgtcattgaaaaaagaaagcggctcaacggccagaccacatacg
gtcagtcgggtgggggtgttgggtgggggattgatgggcggcggtattgccaatgtcacg
gccactcgcgccggtttaccggtaagaattaaagatattaatttgcaaggaatcaatcag
gcgctgaaatatacctgggatgcgttaggcaagcgggtgcgcagtaaacgtctgcggcca
gcagagcgtcaacgtcagatgatgctgatttcaggtaccaccgattacagcggctttgac
cacgtggatatcgtgattgaagcggtattcgaagacttggcactaaaacaaaagatggtg
gccgagatcgaagccaatacggcggcacactgcatctttgcctcaaatacttcatctttg
cccatcagtcagattgctgcgggtgcccatcggccagagcagattattggtctgcattat
tttagcccggtagataaaatgccgctggtggaagtgattcctcatgctggaaccagtgaa
gaaactatcgctacaaccgtggctttggcgcaaaaacagggtaaaacggcgatagttgtt
ggcgatcgcgccggtttctatgtcaaccgcattcttgctccttatatcaacgaaggtgcc
ctttgcctgctggatgctgagccgatcgagtcgatagataaggcgttagtcgattttggc
ttcccggtcgggccgctaacgttgctggatgaagtagggattgatgtgggcaccaaaatt
atgccgattttggtggagcagcttggttcacgctttgcagcgccttcgtctctggacgcc
attttgaaagatgggcgtaaagggcgaaaaaatggtcgaggtttctacctctatccggcg
aaatcgtcgagattcactctgaagaaaacccctgccagacaggctgatagccatatttac
ggattattgggtatcacggctaaagctcatttacagcataaagtcattgctcagcgttgc
gtgatgatgatgcttaatgaagccgttcgctgtctggatgaatcgatcattcgttgccca
cgggacggtgatattggcgcagtattcggtattggcttcccgccatttcttggtggaccg
ttccgctatttggatcgactgggcgcggatactgcagtcaaggccttgaggctgttggag
caacagtacggtgaacgttttacaccttgtgagcgcctgattgatatggccgctcaaggg
gctaaattctaccctgatgatacgctggatatggtggaactatag

DBGET integrated database retrieval system