KEGG   Yersinia similis: BF17_02255Help
Entry
BF17_02255        CDS       T03057                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
ysi  Yersinia similis
Pathway
ysi00030  Pentose phosphate pathway
ysi01100  Metabolic pathways
ysi01110  Biosynthesis of secondary metabolites
ysi01120  Microbial metabolism in diverse environments
ysi01130  Biosynthesis of antibiotics
ysi01200  Carbon metabolism
ysi01230  Biosynthesis of amino acids
Module
ysi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ysi_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ysi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BF17_02255
Enzymes [BR:ysi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BF17_02255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC RNase_PH_C Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AHK18317
UniProt: A0A0T9RDJ6
LinkDB All DBs
Position
complement(405203..405859)
Genome map
AA seq 218 aa AA seqDB search
MTQDELKKAVGWAALDYVKPGTIVGVGTGSTAAHFIDALGSIKHQIEGAVSSSDASTAKL
KSYGIPVFDCNDVDVLDIYVDGADEINGQMQMIKGGGAALTREKIIAAIARKFICIADES
KQVGVLGKFPLPVEVIPMARSYVARELIKLGGLPEYRQNVLTDNGNVILDIHNLSILDAI
ALENKINGIAGVVTVGLFANRGADVALIGTANGVKVIG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggatgaacttaaaaaagcggtaggctgggcagcattagattacgttaaaccc
ggtactattgttggtgtcggcactggttcaaccgcggcgcattttattgatgcgctaggt
tcgattaaacaccagattgaaggtgctgtttccagttctgatgcttcaaccgccaagctg
aaaagctatggtatccctgtatttgattgcaatgacgttgatgtattggatatctatgtt
gatggcgctgacgaaattaacggccagatgcagatgattaaaggcggtggcgcagcactg
acccgagagaaaattattgcggctatcgcccggaaatttatctgtattgctgatgaatcc
aaacaagtcggtgtgctgggtaagttcccgctgccagtcgaagtgatcccgatggcccgt
tcttatgtggcgcgtgagctgattaagttgggtgggctgcctgaataccgccagaatgtc
ctgaccgataacggtaacgttattctggatatccacaacttgagtattttggatgctatc
gctttagagaataaaattaatggcattgccggtgtcgtaacggtggggctatttgcgaat
cgtggtgctgacgtggccctgattggtacggccaatggtgttaaagtgattggataa

DBGET integrated database retrieval system